StockTune: Free stock music and songs
StockCake: Free AI stock photosAI Photosenergeticsaxophonedarkopening ceremonyepic orchestralraag bhairavitempleoffice background musicgentle alarmcinematicmp3 downloader juice free musicpunjabi bhangraindianacoustic guitar90 bpmindiahdhub4u download all bollywood movies in hindihdhub4u movie download in hindi msynthesizerbansuri flute
An otherworldly composition combines serene synths with earthy elements, crafting a tranquil, meditative, and immersive listening experience. Ideal for deep relaxation and contemplation.
Public DomainAI Generated

Celestial Lotus Tranquility

Meditative Sounds Blending Cosmic And Natural Organic Elements

80 BPMD minor01:34

An otherworldly composition combines serene synths with earthy elements, crafting a tranquil, meditative, and immersive listening experience. Ideal for deep relaxation and contemplation.

synthesizerexperimentalambientetherealserenemeditativerelaxingexperimentalambientcosmicorganictranquilimmersivesoothingintrospectivesoft

Related Tags

ambientambienttranquiltranquilsoothingsoothingintrospectiveintrospectiveserenesereneetherealetherealsoftsoftrelaxingrelaxingmeditativemeditativepeacefulpeacefuldreamydreamy80bpm80bpmcosmiccosmic

Similar Stock Music

relaxing experimental melodies with celestial and organic influences
relaxing experimental melodies with celestial and organic influences
stellar lotus garden
01:4185 BPMC major
experimentalambientetherealsynthesizer
subtle electronic pulses amidst nature's calm
subtle electronic pulses amidst nature's calm
echoes beneath leaves
01:5280 BPMD minor
ambientexperimentalrelaxingsynthesizer
floating smoothly through celestial soundscapes
floating smoothly through celestial soundscapes
whispers of the void
01:3990 BPMD minor
ethereal waveambientetherealsynthesizer
serene melody, floating through cosmic tranquility
serene melody, floating through cosmic tranquility
dreams under starlight
01:5090 BPMG minor
loungeambient loungeserenepiano
a gentle fusion of ambient sounds and organic textures
a gentle fusion of ambient sounds and organic textures
whispers beneath starlight
01:4680 BPMF major
ambientetherealrelaxinghang drum
calming, soft melodies guide toward serene reflection
calming, soft melodies guide toward serene reflection
visions of calm waters
01:41120 BPMA minor
ambientexperimentalpeacefulsynthesizer
tranquil melodies merging experimental tones with soothing rhythms
tranquil melodies merging experimental tones with soothing rhythms
echoes of silent waves
01:5990 BPMG minor
ambientetherealrelaxinghang drum
floating melodies in a sonic dreamscape.
floating melodies in a sonic dreamscape.
celestial dreams unfold
01:5480 BPMC minor
ethereal wavepsychedelicetherealsynthesizer
ethereal tones mingle with gentle dissonance.
ethereal tones mingle with gentle dissonance.
whispers of the void
01:5980 BPMAb major
ambientexperimentalcontemplativeelectric piano
gentle piano stirs deep emotional waters
gentle piano stirs deep emotional waters
echoes by the brook
01:57110 BPME minor
ambientlyricalrelaxingpiano
nature sounds blend with synthetic layers
nature sounds blend with synthetic layers
whispers of the forest
01:29155 BPMC minor
ambientexperimentalrelaxingsynthesizer
ethereal sounds meet soft, ambient undercurrents.
ethereal sounds meet soft, ambient undercurrents.
whispers of silent waves
01:2080 BPMF major
ethereal waveambientsereneelectric piano
serene pulses mingle with ethereal sweeps.
serene pulses mingle with ethereal sweeps.
dreams of silent echoes
01:3880 BPMC minor
ambientethereal waverelaxingsynthesizer
peaceful sonic journey through the cosmos
peaceful sonic journey through the cosmos
starry sky meditation
01:4990 BPMG major
psychedelicambientpeacefulelectric piano
relaxed piano drives this reflective journey
relaxed piano drives this reflective journey
echoes through time
01:2590 BPMA minor
contemporary classicalneo classicalpeacefulpiano
soothing melody flows like gentle water.
soothing melody flows like gentle water.
waves of whispered memories
01:33110 BPMC minor
ambientethereal ambientdreamyharp
delicate piano with haunting, minimalistic vibes.
delicate piano with haunting, minimalistic vibes.
echoes in silence
01:50160 BPMC minor
ambientexperimentalcontemplativeelectric piano
ambient ethereal pads float through cosmic silence
ambient ethereal pads float through cosmic silence
whispers across cosmos
03:2590 BPMA minor
ambientspace ambientetherealethereal pads
serene flow with cosmic undertones
serene flow with cosmic undertones
dreams beneath stars
01:57100 BPMF major
psychedelicambientpeacefulelectric piano
experimental nature inspired tones blending into ambient tranquility
experimental nature inspired tones blending into ambient tranquility
serene nature soundscape
01:56110 BPMC minor
experimentalambientpeacefulsynthesizer
ambient electronic bliss for a night under the stars
ambient electronic bliss for a night under the stars
peaceful starry night
01:5480 BPMG major
electronicaambient electronicapeacefulsynthesizer
ethereal, introspective soundscape invoking tranquility and dreaminess
ethereal, introspective soundscape invoking tranquility and dreaminess
ethereal melodies of tranquility
01:47100 BPMD minor
ambientartdreamyacoustic guitar
subtle tones create a calming atmosphere
subtle tones create a calming atmosphere
whispers of the night
02:0080 BPMF# minor
ambientintimate ambientrelaxingelectric piano
relaxing, enveloping sounds for introspective journeys.
relaxing, enveloping sounds for introspective journeys.
dreamscape voyager's echo
02:0080 BPMF# major
psychedelicambientetherealsynthesizer
nighttime sounds in a surreal, relaxing forest setting
nighttime sounds in a surreal, relaxing forest setting
mystical forest night soundscape
01:33110 BPMA minor
ambientexperimental ambientetherealplucked strings
soft ambient textures enveloping peaceful silence
soft ambient textures enveloping peaceful silence
whispers from the void
01:45140 BPMF minor
ambientnüpeacefulelectric piano
gentle notes play through the deep silence
gentle notes play through the deep silence
echoes in silence
02:0070 BPMA minor
ambientchillwaverelaxingelectric piano
gentle synths swirl in a dreamlike sequence
gentle synths swirl in a dreamlike sequence
whispers in the mist
02:00110 BPMA minor
ethereal waveambientsoothingsynthesizer
hypnotic instrumentals with soothing, otherworldly melodies evoking calm vibes
hypnotic instrumentals with soothing, otherworldly melodies evoking calm vibes
tranquil cosmic dreamscape
01:5275 BPME minor
psychedelicspace rockdreamysynthesizer
ethereal tones, peaceful introspective music.
ethereal tones, peaceful introspective music.
echoes of silence
01:15100 BPMC minor
ambientethereal wavepeacefulsynthesizer
soothing sounds with a weird twist
soothing sounds with a weird twist
echoes through strangeness
03:3590 BPMG# minor
ambientexperimentalserenesynthesizer
calming space journey music with hypnotic and dreamy effects
calming space journey music with hypnotic and dreamy effects
serene cosmic voyage
01:43120 BPMD minor
psychedelicspace rockdreamysynthesizer
reflection provoking soundscapes blend harmoniously with cosmic ethereal elements.
reflection provoking soundscapes blend harmoniously with cosmic ethereal elements.
galactic inner landscapes
01:56120 BPMA minor
ethereal waveambientintrospectivesynthesizer
gentle beats, subtle melodic flows
gentle beats, subtle melodic flows
whispers in the night
01:58140 BPMA minor
trapmellow traprelaxingelectric piano
melodies flow like soft morning light
melodies flow like soft morning light
tranquil beats at dawn
01:2885 BPMA minor
drum and bassliquid funkrelaxingelectric piano
soft harp strings, calm meditative ambiance
soft harp strings, calm meditative ambiance
echoes of calm streams
01:36100 BPMD minor
ambientdronepeacefulharp
soft electronic beats for deep relaxation
soft electronic beats for deep relaxation
gentle electronic drift
01:4585 BPMA minor
edmchillsteprelaxingsynthesizer
a tranquil blend of ambient textures and minimalist beats
a tranquil blend of ambient textures and minimalist beats
echoes in stillness
01:2780 BPMA minor
idmambient idmsoothingsynthesizer
ethereal pads envelop in celestial calmness
ethereal pads envelop in celestial calmness
echoes of starlight whisper
01:24130 BPMD minor
electronicambientetherealsynthesizer
a gentle journey through cosmic soundscapes
a gentle journey through cosmic soundscapes
dreams beneath stars
01:42110 BPMD minor
ambientpsychedelic ambientetherealsynthesizer
traditional flute meets modern ambiance.
traditional flute meets modern ambiance.
whispers of ancient winds
02:0080 BPMC minor
ambientethnic fusionmysticalshakuhachi
relaxed tones, created for soothing listening.
relaxed tones, created for soothing listening.
whispers of the wind
01:51140 BPME minor
experimentalambientrelaxingelectric piano
dark melodies woven into soothing sounds.
dark melodies woven into soothing sounds.
shadowed whispers echoing
01:20110 BPMA minor
easy listeningdark ambientdarkpiano
soothing and calming psychedelic sound journey through dreamy realms
soothing and calming psychedelic sound journey through dreamy realms
cotton candy clouds
01:49185 BPME major
psychedelic rockambient psychedeliadreamyelectric guitar
experience serenity with hauntingly beautiful music
experience serenity with hauntingly beautiful music
echoes in silence
02:00150 BPMC major
ethereal waveambientetherealsynthesizer
soft tones blend with airy sounds
soft tones blend with airy sounds
whispers of the wind
04:00135 BPMD minor
ambientetherealrelaxingflute
dreamy melody floats like autumn leaves
dreamy melody floats like autumn leaves
whispers in serene waters
01:3385 BPMC major
ambientlyricalrelaxingpiano
soft tones ease the day's stress away
soft tones ease the day's stress away
echoes of serenity
01:47145 BPMC minor
downtempoambientcontemplativeelectric piano
calming psychedelic rock with serene, hypnotic melodies throughout.
calming psychedelic rock with serene, hypnotic melodies throughout.
celestial ocean tranquility
01:39140 BPMA minor
psychedelic rockambient rockdreamyelectric guitar
gentle psychedelic vibes, calming, spacey, soothing instrumental experience
gentle psychedelic vibes, calming, spacey, soothing instrumental experience
dreamy cosmic landscapes
01:3880 BPMC major
psychedelicpsybientdreamysynthesizer
soothing psychedelic tones, ambient, journey through a peaceful cosmos
soothing psychedelic tones, ambient, journey through a peaceful cosmos
ethereal space odyssey
01:5980 BPMC major
psychedelicpsybientdreamysynthesizer
soothing piano composition for relaxation
soothing piano composition for relaxation
echoes of tranquility
01:30145 BPMC minor
ambientminimalistserenepiano
serenity wrapped in an unconventional sound
serenity wrapped in an unconventional sound
whispers of the odd
03:59185 BPMD minor
ambientexperimentalserenesynthesizer
ethereal echoes under a moonlit sky
ethereal echoes under a moonlit sky
whispers of lunar seas
01:25130 BPMC minor
dream popambient popserenesynthesizer
magical, tranquil tune with surreal, soothing melodies.
magical, tranquil tune with surreal, soothing melodies.
dreaming of velvet skies
01:3980 BPMC minor
chilloutartdreamysynthesizer
relaxing, ethereal sounds for peaceful contemplation
relaxing, ethereal sounds for peaceful contemplation
dreamscapes of tranquil spaces
01:3490 BPMC major
ambientexperimentalpeacefulsynthesizer
soft melodies float in a tranquil soundscape
soft melodies float in a tranquil soundscape
echoes of silent voices
01:58105 BPMC minor
ambientethereal wavesereneelectric piano
soft sounds shaped by nature's breath.
soft sounds shaped by nature's breath.
echoes between trees
01:32180 BPMA minor
downtempoambientrelaxingflute
lulling tones blend with gentle rhythms.
lulling tones blend with gentle rhythms.
chill waves serenade
01:2780 BPME minor
ambientchilloutrelaxingelectric piano
a soft soundscape exploring the serenity of the universe.
a soft soundscape exploring the serenity of the universe.
celestial echoes of light
01:55145 BPMF# minor
ambientspace ambientotherworldlysynthesizer
ethereal tones blend into deep serene waves
ethereal tones blend into deep serene waves
whispers of the abyss
01:59100 BPMA minor
ethereal waveambientserenesynthesizer
calm, ethereal melodies inspired by distant galaxies and stars.
calm, ethereal melodies inspired by distant galaxies and stars.
whispers from distant stars
01:58135 BPMD# minor
ambientdronecalmtheremin
soft piano chords evoke morning serenity and calm introspection
soft piano chords evoke morning serenity and calm introspection
tranquil dawn breaking
01:51150 BPMG major
ambientminimalismpeacefulpiano
soothing sounds transport listeners to tranquil galaxies
soothing sounds transport listeners to tranquil galaxies
gentle cosmic waves
01:5980 BPMBb major
electronicachillwavecalmsynthesizer
etheric melodies create a peaceful, introspective feeling
etheric melodies create a peaceful, introspective feeling
serene melodies under stars
01:3480 BPMC major
downtempodreamytranquilsynthesizer
gentle piano in cosmic calmness
gentle piano in cosmic calmness
starry night serenade
01:50180 BPMEb major
loungeambient loungeserenepiano
lyrical waves in serene soundscapes
lyrical waves in serene soundscapes
whispers of ethereal dreams
01:3480 BPMC major
ambientethereal wavesereneelectric piano
tranquil, underwater visions with soothing, ethereal soundscapes.
tranquil, underwater visions with soothing, ethereal soundscapes.
subaquatic tranquil visions
01:5290 BPMF minor
easy listeningpsybientdreamysynthesizer
transport to peaceful woodland serenity
transport to peaceful woodland serenity
echoes through trees
01:04120 BPMC minor
new ageambientpeacefulflute
sounds swirl in hypnotic patterns
sounds swirl in hypnotic patterns
whispers of the mind
01:5380 BPMF minor
psychedelicchillwavedreamysitar
futuristic sounds blending with natural elements.
futuristic sounds blending with natural elements.
whispers of tomorrow's echo
04:0090 BPMD minor
ambientfuturisticetherealsynthesizer
experience the soothing cosmic tranquility
experience the soothing cosmic tranquility
stellar mind melodies
01:49150 BPMC minor
ambientpsychedelic ambientetherealsynthesizer
soothing tones blend into ethereal soundscapes.
soothing tones blend into ethereal soundscapes.
whispers of the void
01:55105 BPMG minor
ambientexperimentalsereneharp
soft harp under a moonlit sky's embrace.
soft harp under a moonlit sky's embrace.
echoes of lunar oceans
01:56140 BPMG minor
dream popmysticaletherealharp
an ethereal journey through sound and imagination.
an ethereal journey through sound and imagination.
echoes of future's whisper
04:00130 BPMG minor
ambientfuturisticetherealsynthesizer
a soothing, deep, immersive instrumental experience
a soothing, deep, immersive instrumental experience
shadows linger long
01:29110 BPMA minor
darkwaveambient darkwavemelancholicelectric piano
soft electronic melodies invoking a calm, dreamlike state.
soft electronic melodies invoking a calm, dreamlike state.
calm horizon serenity
01:21100 BPMA minor
chillwaveambientnostalgicsynthesizer
tranquil tones meld with smooth rnb vibes
tranquil tones meld with smooth rnb vibes
misty soul serenade
02:0080 BPMC major
rnbchill rnbsereneelectric piano
a serene nocturnal journey
a serene nocturnal journey
whispers of the night
01:5880 BPMA minor
ambientcinematicetherealelectric guitar
minimal elements blend with serene tones
minimal elements blend with serene tones
whispers of serene light
01:45160 BPMC minor
ambientminimalistrelaxingelectric piano
ethereal melodies and surreal harmonies create a smooth journey.
ethereal melodies and surreal harmonies create a smooth journey.
dreamy sonic landscape
01:41130 BPMA minor
experimentalsmooth jazzetherealtheremin
explore spaces between silence and melody in rock
explore spaces between silence and melody in rock
echoes of starlight
04:00110 BPMB minor
experimental rockambient rocksereneelectric guitar
gentle flute echoes through tranquil space
gentle flute echoes through tranquil space
whispers of the mind
01:58140 BPMEb major
ambientetherealsereneflute
a journey through cosmic soundscapes, mesmerizing beats.
a journey through cosmic soundscapes, mesmerizing beats.
dreams beneath stars
01:5590 BPME minor
psychedelicambient dubetherealsynthesizer
a dreamy ethereal instrumental evoking distant stars and soft whispers
a dreamy ethereal instrumental evoking distant stars and soft whispers
echoes of distant dreams
01:58100 BPME minor
ethereal waveambientdreamysynthesizer
soothing echoes meld with subtle beats.
soothing echoes meld with subtle beats.
whispers among stars
01:4285 BPMD minor
electronicaambient electropeacefulsynthesizer
ethereal soundscape, surreal and deeply introspective
ethereal soundscape, surreal and deeply introspective
whispers across stars
01:4380 BPMC major
ethereal waveambient popintrospectivesynthesizer
soothing ambient rock featuring transcendent, dreamy soundscapes.
soothing ambient rock featuring transcendent, dreamy soundscapes.
oceanic dreamscape journey
01:31155 BPME minor
psychedelic rockambient rockdreamyelectric guitar
gentle melodies mimic soft forest whispers
gentle melodies mimic soft forest whispers
whispers of the forest
04:00105 BPMD major
ambientnature soundscapesereneflute
soft tones meld into background serenity
soft tones meld into background serenity
quiet thoughts drift
01:4280 BPMC major
ambientminimalistpeacefulelectric piano
tranquil journey into peaceful solitude
tranquil journey into peaceful solitude
serene escape
02:00155 BPMD major
ambientdowntempopeacefulacoustic guitar
gentle echoes promoting calm and relaxation
gentle echoes promoting calm and relaxation
soothing echo tides
01:23110 BPMC minor
ambient houseminimalistpeacefulsynthesizer
soft beats combined with tranquil, starry sky vibes
soft beats combined with tranquil, starry sky vibes
celestial dance groove
01:57100 BPMD# minor
discoambient discotranquilsynthesizer
delicate melodies whisper under serene sonic waves.
delicate melodies whisper under serene sonic waves.
echoes of quiet oceans
01:53100 BPMC major
ethereal waveambientsereneelectric piano
soothing blend of synth and nature sounds
soothing blend of synth and nature sounds
misty echoes unwind
01:5880 BPMC minor
chillwaveambient fusionrelaxingsynthesizer
delicate melodies dance through tranquil soundscapes.
delicate melodies dance through tranquil soundscapes.
gentle whispers through time
01:42155 BPMF# minor
ambientneo classicalserenepiano
soothing piano amidst mysterious shades
soothing piano amidst mysterious shades
echoes from the dark
01:5480 BPMC major
ambientdark ambientmelancholicpiano
a soothing ethereal track embodying whispers and dreamy ambience
a soothing ethereal track embodying whispers and dreamy ambience
silent echoes reverberate
01:58145 BPMD minor
ethereal waveambientdreamysynthesizer
ethereal sounds entwined with dreamy electronica melodies
ethereal sounds entwined with dreamy electronica melodies
celestial dreamscapes unfolding
02:00100 BPMF minor
electronicaetherealnostalgicsynthesizer
gentle electronic sounds with subtle rhythmic percussive elements
gentle electronic sounds with subtle rhythmic percussive elements
floating through echoes
01:44170 BPME minor
idmambient idmpeacefulsynthesizer