StockTune: Free stock music and songs
StockCake: Free AI stock photosAI Photosinstrumental reggaeindian musicaudiopopularindian classicalnostalgiccalmboom bapelectronicpunjabi dholsoul bluesegyptianbackground musictalking drumromanticlofiballadindigenous australiantraphindustani classical
Visualize a high stakes chase through a towering digital metropolis, with throbbing synthetic beats pushing the adrenaline. Fast paced synth patterns and driving rhythms envelop the listener in a futuristic soundscape brimming with tension.
Public DomainAI Generated

Digital Circuit Hunts

Rapid Pursuit Through Towering Digital Cityscapes, Throbbing Synthetic Pulses

100 BPMB minor01:51

Visualize a high stakes chase through a towering digital metropolis, with throbbing synthetic beats pushing the adrenaline. Fast paced synth patterns and driving rhythms envelop the listener in a futuristic soundscape brimming with tension.

synthesizercyberpunksynthwavetensefuturisticurgentsynthwavedystopianneonfast pacedtensionsynthesizerchaseintense

Related Tags

cyberpunkcyberpunkfuturisticfuturisticneonneonsynthwavesynthwavedystopiandystopianintenseintensechasechaseelectronicelectronic100bpm100bpmdarkdarkurbanurbanhigh energyhigh energypulsatingpulsating

Similar Stock Music

futuristic chase through neon lit dystopian streets, pulsating beats
futuristic chase through neon lit dystopian streets, pulsating beats
neon night chasers
01:55115 BPMG minor
cyberpunksynthwavetensesynthesizer
an intense cyberpunk chase through a neon lit dystopian city
an intense cyberpunk chase through a neon lit dystopian city
neon shadows run deep
01:43150 BPMD minor
synthwavedarkwavefuturisticsynthesizer
anxious cyberpunk soundscape with pulsating futuristic vibes.
anxious cyberpunk soundscape with pulsating futuristic vibes.
neon chase through dystopia
01:47100 BPMD minor
cyberpunkfuturisticanxioussynthesizer
suspenseful beats build in futuristic cyberpunk chase
suspenseful beats build in futuristic cyberpunk chase
urban neon pursuit
01:29100 BPMA minor
electroniccyberpunksuspensefulsynthesizer
tense cyberpunk track with electric, dystopian atmosphere.
tense cyberpunk track with electric, dystopian atmosphere.
dystopian neon pursuit
01:39100 BPME minor
cyberpunkfuturisticanxioussynthesizer
pulsating beat, futuristic synths, groovy dystopian atmosphere
pulsating beat, futuristic synths, groovy dystopian atmosphere
neon alleyway chase
01:4990 BPMD minor
cyberpunksynthwaveintensesynthesizer
a high octane sonic journey through a cybernetic neon metropolis
a high octane sonic journey through a cybernetic neon metropolis
circuit breaker overdrive
01:35170 BPME minor
synthwavedarkwavefuturisticsynthesizer
futuristic tension builds in urban neon environment
futuristic tension builds in urban neon environment
neon alley chase
01:25110 BPMD minor
electroniccyberpunksuspensefulsynthesizer
thrilling cyberpunk with driving beats synthesizer hooks
thrilling cyberpunk with driving beats synthesizer hooks
neon shadows midnight chase
01:47145 BPME minor
electrocyberpunkfreneticsynthesizer
pulsating electronic beats for a high energy dystopian chase.
pulsating electronic beats for a high energy dystopian chase.
neon city rush
01:30100 BPMBb minor
electroniccyberpunkenergeticsynthesizer
high energy cyberpunk with relentless beats and synths
high energy cyberpunk with relentless beats and synths
neon night chase
01:38100 BPMF minor
electroniccyberpunkenergeticsynthesizer
experience high speed futuristic chases heart pounding beats riffs
experience high speed futuristic chases heart pounding beats riffs
neon grit urban hunt
01:08140 BPMD# minor
electrocyberpunkfreneticsynthesizer
chase scene amidst neon lights and futuristic cityscape
chase scene amidst neon lights and futuristic cityscape
neon night pursuit
01:58100 BPMD minor
synthwavedramatic synthwavethrillingsynthesizer
a high octane cyber chase through a dystopian neon city
a high octane cyber chase through a dystopian neon city
digital shadows pursuit
01:42150 BPMF minor
electronicsynthwavethrillingsynthesizer
futuristic beats, intense synths, urban cyberchase track
futuristic beats, intense synths, urban cyberchase track
cybernetic night race
01:21115 BPME minor
cyberpunksynthwaveintensesynthesizer
dark futurism with forceful rhythm and moody synths.
dark futurism with forceful rhythm and moody synths.
neon dystopian grit
01:53100 BPMC minor
synthwavecyberpunkdarksynthesizer
sinister chasing vibes in a neon drenched cyberpunk cityscape
sinister chasing vibes in a neon drenched cyberpunk cityscape
cyber shadow hunter
01:53100 BPMD# minor
synthwavedark synthwavemenacingsynthesizer
intense, futuristic, passionate rhythms with driving beats.
intense, futuristic, passionate rhythms with driving beats.
neon heartbeat pulse
01:28105 BPME minor
cyberpunkfuturistic synthwavepassionatesynthesizer
dark synth melodies over industrial beats in dystopian future.
dark synth melodies over industrial beats in dystopian future.
neon streets breakdown
01:43100 BPME minor
electroniccyberpunkdarksynthesizer
an intense synthwave track with dark, furious energy.
an intense synthwave track with dark, furious energy.
neon fury unleashed
01:29100 BPMF minor
synthwavedark synthwaveangrysynthesizer
vibrant night, thrilling electronic drive, pulsating beats
vibrant night, thrilling electronic drive, pulsating beats
electric night race
01:55130 BPME minor
cyber punkcyber waveexcitedsynthesizer
a thrilling cyberpunk chase through neon soaked cityscape
a thrilling cyberpunk chase through neon soaked cityscape
neon streets chase
01:47110 BPMD minor
electronicsynthwavethrillingsynthesizer
high-speed chase through neon-lit streets
high-speed chase through neon-lit streets
neon nights pursuit
02:00100 BPMEb major
electroniccyberpunkadventurouselectric guitar
electric beats creating dystopian, high energy futuristic musical landscapes.
electric beats creating dystopian, high energy futuristic musical landscapes.
neon uprising pulse
01:39100 BPMD minor
cyberpunksynthwaveelectrifyingsynthesizer
emotional journey through cyberpunk landscapes and intense beats.
emotional journey through cyberpunk landscapes and intense beats.
electric city romance
01:50110 BPMG# minor
cyberpunkfuturistic synthwavepassionatesynthesizer
intense electronic chase theme brimming with energy, suspense.
intense electronic chase theme brimming with energy, suspense.
pursuit through neon streets
01:23100 BPMC major
electronicsynthwavethrillingsynthesizer
thrilling beats amid neon soaked cyberpunk cityscape action
thrilling beats amid neon soaked cyberpunk cityscape action
neon skyline chase
01:55180 BPMA minor
electroniccyberpunkthrillingsynthesizer
pulsating basslines drive through neon lit urban scenario
pulsating basslines drive through neon lit urban scenario
cybernetics in neon alley
01:24130 BPME minor
electrosynthwavethrillingsynthesizer
intense beats with sensual undertones and futuristic vibe
intense beats with sensual undertones and futuristic vibe
neon noir seduction
01:59100 BPMC minor
cyberpunkelectroseductivesynthesizer
glowing cityscape, high speed pursuits, intense electronic beats
glowing cityscape, high speed pursuits, intense electronic beats
neon city chase
01:46140 BPME minor
cyber punkcyber waveexcitedsynthesizer
intense synths, dark futuristic beats, setting battle hymn
intense synths, dark futuristic beats, setting battle hymn
cyber battle hymn
01:54100 BPMD minor
epiccyberpunkfierysynthesizer
intense pursuit through neon lit cyberpunk city streets
intense pursuit through neon lit cyberpunk city streets
midnight neon chase
01:33115 BPME minor
synthwavedramatic synthwavethrillingsynthesizer
menacing synthwave chase through futuristic cyber cityscape
menacing synthwave chase through futuristic cyber cityscape
neon nightmare pursuit
01:5585 BPMA minor
synthwavedark synthwavemenacingsynthesizer
rapid beats echo in neon lit futuristic urban scape
rapid beats echo in neon lit futuristic urban scape
neon night city chase
01:51115 BPMD minor
electrosynthwavethrillingsynthesizer
futuristic yet soulful vibes in a neon cityscape
futuristic yet soulful vibes in a neon cityscape
neon heartbeat echoes
01:5690 BPMA minor
cyberpunksynthwavebittersweetsynthesizer
ominous, futuristic beats with dark, synth driven atmospheres
ominous, futuristic beats with dark, synth driven atmospheres
dystopian city shadows
01:49100 BPME minor
synthwavedark synthwaveominoussynthesizer
intense futuristic melody pushing through urban chaos
intense futuristic melody pushing through urban chaos
neon nightfall chase
01:45120 BPMF minor
cyberpunkelectroconfidentsynthesizer
dark rhythm driven beats amidst futuristic cityscape ambiance
dark rhythm driven beats amidst futuristic cityscape ambiance
neon streets unleashed
01:57150 BPME minor
electrocyberpunkdarksynthesizer
an immersive journey through futuristic soundscapes and beats.
an immersive journey through futuristic soundscapes and beats.
digital neon dreamscape
01:45100 BPMC minor
electroniccyberpunkfuturisticsynthesizer
synth infused beats in dystopian cityscape; action packed and thrilling
synth infused beats in dystopian cityscape; action packed and thrilling
neon dreams awakening
01:52100 BPMG minor
electroniccyberpunkenergeticsynthesizer
an intense synthwave track set in a futuristic cityscape
an intense synthwave track set in a futuristic cityscape
cybernetic midnight run
01:3395 BPME minor
synthwavedarksynthenergeticsynthesizer
an intense instrumental capturing a nighttime cyberpunk pursuit atmosphere
an intense instrumental capturing a nighttime cyberpunk pursuit atmosphere
neon velocity chase
01:43130 BPMD# minor
synthwavedarksynthenergeticsynthesizer
futuristic beats with dark, electrifying urban vibes
futuristic beats with dark, electrifying urban vibes
neon dystopia pulse
01:46115 BPMF minor
cyberpunkdark synthwavemysterioussynthesizer
dark, futuristic beats in a neon lit city
dark, futuristic beats in a neon lit city
electric city nights
01:33115 BPMF minor
cyberpunkdark synthwavemysterioussynthesizer
eerie beat, neon shadows, urban dystopian electronic soundscape
eerie beat, neon shadows, urban dystopian electronic soundscape
neon shadows pulse
01:46100 BPMC minor
electroniccyberpunkforebodingsynthesizer
high energy cyberpunk theme with futuristic beats.
high energy cyberpunk theme with futuristic beats.
futuristic neon chase
01:22130 BPMG minor
electroniccyberpunkenergeticsynthesizer
high energy futuristic beats with vibrant synth melodies
high energy futuristic beats with vibrant synth melodies
pulsing neon metropolis
02:00140 BPMA minor
electronicsynthwavefuturisticsynthesizer
high energy electro capturing futuristic escape through cybernetic cityscapes
high energy electro capturing futuristic escape through cybernetic cityscapes
cyber escape odyssey
01:35170 BPME minor
electrodark electrothrillingsynthesizer
intense rhythmic beats navigate cybernetic urban jungle.
intense rhythmic beats navigate cybernetic urban jungle.
neon streets after midnight
01:54100 BPMC minor
synthwavedark synthwavefuturisticsynthesizer
thrilling ride through neon drenched dystopian future cityscape
thrilling ride through neon drenched dystopian future cityscape
cyber city pursuit
01:31100 BPMD# minor
cyberpunksynthwavefuturisticsynthesizer
an aggressive, dark synthwave track with relentless energy.
an aggressive, dark synthwave track with relentless energy.
relentless neon fury
01:5490 BPMC minor
synthwavedark synthwaveangrysynthesizer
epic cyberpunk soundscapes of neon lights and futuristic visions
epic cyberpunk soundscapes of neon lights and futuristic visions
echoes of neon skies
01:58110 BPME minor
synthwavedarksynthelectricsynthesizer
intense cyberpunk vibes with a hypnotic, futuristic feel
intense cyberpunk vibes with a hypnotic, futuristic feel
neon dreamscape descent
01:18100 BPME minor
electroniccyberpunkhypnoticsynthesizer
dark synths drive through futuristic neon landscapes
dark synths drive through futuristic neon landscapes
neon streets pulse
01:51130 BPME minor
electroniccyberpunkdarksynthesizer
electronic beats and synths create a hyper speed journey
electronic beats and synths create a hyper speed journey
futuristic urban soundscape
01:51100 BPMC minor
electroniccyberpunkenergeticsynthesizer
heavy electronic beats with sharp synths in cybernetic world.
heavy electronic beats with sharp synths in cybernetic world.
shadow circuit riot
01:34145 BPMD minor
electroniccyberpunkdarksynthesizer
fast synths create cybernetic chase atmosphere at nighttime
fast synths create cybernetic chase atmosphere at nighttime
digital night runner
01:56140 BPMA minor
electroniccyberpunkthrillingsynthesizer
dark futuristic track embodying high tech dystopian city vibrations
dark futuristic track embodying high tech dystopian city vibrations
cybernetic dreams collapse
01:4995 BPMA minor
electronicsynthwavedramaticsynthesizer
high octane beats pulse with neon lit intensity.
high octane beats pulse with neon lit intensity.
neon urban warfare
01:18100 BPME minor
electroniccyberpunkepicsynthesizer
haunting synths with pulsating rhythms and dark vibes
haunting synths with pulsating rhythms and dark vibes
dystopian synthwave dreams
01:50100 BPME minor
electroniccyberpunkfuturisticsynthesizer
driven beats, futuristic soundscapes, intense vibes, cyberpunk adventure
driven beats, futuristic soundscapes, intense vibes, cyberpunk adventure
neon city pulse
01:55100 BPME minor
electroniccyberpunkintensesynthesizer
fast paced, futuristic beats with pulsing electronic synths
fast paced, futuristic beats with pulsing electronic synths
neon dreams unleashed
01:36155 BPMF minor
electronicsynthwavefuturisticsynthesizer
experience the vibe of a neon drenched cyber city.
experience the vibe of a neon drenched cyber city.
electric neon city rush
01:2990 BPMF minor
cyberpunksynthwavefuturisticsynthesizer
pulsing, futuristic night race with driving beats and synths
pulsing, futuristic night race with driving beats and synths
cyberpunk night street race
01:24120 BPME minor
electropopedgyenergeticsynthesizer
gritty synthesizers with dark, forceful rhythms and intense mood.
gritty synthesizers with dark, forceful rhythms and intense mood.
dystopia synthwave journey
01:45180 BPMC minor
synthwavecyberpunkdarksynthesizer
futuristic beats with high energy and intensity.
futuristic beats with high energy and intensity.
neon city chase
01:51130 BPMG minor
electroniccyberpunkenergeticsynthesizer
pulsing futuristic beats illuminating dark urban environments
pulsing futuristic beats illuminating dark urban environments
cybernetic pulse city
01:47120 BPMA minor
electrocyberpunkdarksynthesizer
soulful expressions within a high tech, neon lit urban jungle
soulful expressions within a high tech, neon lit urban jungle
cybernetic blues harmonies
01:12110 BPMC major
cyberpunksynthwavebittersweetsynthesizer
fast paced synthetic beats with dark, relentless atmosphere
fast paced synthetic beats with dark, relentless atmosphere
futuristic urban pursuit
01:58170 BPMF minor
electroniccyberpunkenergeticsynthesizer
fast paced electro blending futuristic synths and gritty basslines
fast paced electro blending futuristic synths and gritty basslines
neon night chase
01:46135 BPMA minor
electrodark electrothrillingsynthesizer
futuristic cyberpunk anthem with soaring synths and driving beats
futuristic cyberpunk anthem with soaring synths and driving beats
cybernetic dreams ascend
01:45105 BPME minor
synthwavedarksynthelectricsynthesizer
fast paced cyberpunk adventure through neon lit cityscape
fast paced cyberpunk adventure through neon lit cityscape
neon nightfall chase
01:34105 BPMD minor
cyberpunksynthwavefuturisticsynthesizer
pulsating rhythms in futuristic urban landscape, evocative emotions
pulsating rhythms in futuristic urban landscape, evocative emotions
neon heartbeat horizon
01:39100 BPMD minor
electroniccyberpunkpassionatesynthesizer
grinding synths, electrifying beats, futuristic cinematic showdown
grinding synths, electrifying beats, futuristic cinematic showdown
neon skyline showdown
01:48140 BPME minor
epiccyberpunkfierysynthesizer
futuristic sounds meet urban tech landscapes.
futuristic sounds meet urban tech landscapes.
neon shadows rise
01:51150 BPMA minor
cyber punkdystopian synthenergeticsynthesizer
a pulsating journey through neon lit, dark landscapes.
a pulsating journey through neon lit, dark landscapes.
cyberpunk city's heartbeat
01:51100 BPMF minor
electronicsynthwavedramaticsynthesizer
a pulsing electronic odyssey through a futuristic cityscape
a pulsing electronic odyssey through a futuristic cityscape
neon dreams
01:58100 BPMA minor
electronicsynthwavefuturisticsynthesizers
escaping through the city's digital shadows under night skies
escaping through the city's digital shadows under night skies
digital nightfall run
01:55100 BPMF minor
electroniccyberpunktensesynthesizer
pulsing beats and radiant synths in cyber chase.
pulsing beats and radiant synths in cyber chase.
cybernetic nightfall chase
01:5695 BPMD minor
electroniccyberpunkepicsynthesizer
high energy chase through futuristic cityscape
high energy chase through futuristic cityscape
neon streets unleashed
01:53130 BPMD minor
cyberpunkenergetic technoupliftingelectric guitar
dynamic high tech beats driving a confident urban chase
dynamic high tech beats driving a confident urban chase
urban tech pursuit
01:25135 BPMC minor
cyberpunkelectroconfidentsynthesizer
a futuristic cyberpunk theme with driving synth beats.
a futuristic cyberpunk theme with driving synth beats.
neon circuit breaker pulse
01:39105 BPME minor
cyberpunksynthwavefuturisticsynthesizer
chase sequence in neon lit, dystopian future
chase sequence in neon lit, dystopian future
neon lit chase
01:46100 BPME minor
cyber punkdark synthwaveintensesynthesizer
intense, pulsating rhythms in vibrant futuristic cityscapes.
intense, pulsating rhythms in vibrant futuristic cityscapes.
techno streets run
01:32140 BPME minor
electroniccyberpunkenergeticsynthesizer
dark, intense, cyberpunk track with pulsing synth rhythms.
dark, intense, cyberpunk track with pulsing synth rhythms.
neon shadows rising
01:52130 BPME minor
electrodark electrohauntingsynthesizer
futuristic city sounds with a relentless, hypnotic beat
futuristic city sounds with a relentless, hypnotic beat
cyborg city's pulse
01:1995 BPMC minor
electroniccyberpunkhypnoticsynthesizer
upbeat cyberpunk beat with neon synth melodies
upbeat cyberpunk beat with neon synth melodies
neon surge metropolis groove
01:45100 BPME minor
cyberpunksynthwaveenergeticsynthesizer
intense and raw beats for dystopian neon lit race
intense and raw beats for dystopian neon lit race
dystopian cityscape chase
01:3090 BPMD minor
electronicindustrialtensesynthesizer
vivid, pulsating beats meet futuristic synths
vivid, pulsating beats meet futuristic synths
neon dreams awake
01:50150 BPME minor
electroniccyber punkenergeticsynthesizer
intense cyberpunk soundtrack evoking neon lit dystopian city streets
intense cyberpunk soundtrack evoking neon lit dystopian city streets
neon shadows overdrive
01:46135 BPME minor
electronicsynthwavedramaticsynthesizer
dark rhythms clash with eerie, futuristic soundscapes
dark rhythms clash with eerie, futuristic soundscapes
neon shadows lurking danger
01:4090 BPMD minor
cyberpunkdark synthwavesinistersynthesizer
high energy beats with evocative synthetic textures throughout.
high energy beats with evocative synthetic textures throughout.
neon city chase
01:52130 BPMA minor
cyberpunkelectrothrillingsynthesizer
dystopian future with dark, pulsating beats and synths
dystopian future with dark, pulsating beats and synths
underworld mechanized night
01:57100 BPMD minor
cyberpunkdarkwavegrittysynthesizer
eerie, driving rhythms in a futuristic cityscape
eerie, driving rhythms in a futuristic cityscape
pulsing digital cityscape
01:49100 BPMA minor
cyberpunkretro futuristichypnoticsynthesizer
echoes of ghostly circuits in urban darkness persistently linger
echoes of ghostly circuits in urban darkness persistently linger
synthetic shadows haunting night
01:21100 BPMA minor
cyberpunksynthwavehauntingsynthesizer
fast paced neon journey through cyber streets.
fast paced neon journey through cyber streets.
city lights whisper
02:30100 BPMA minor
electroniccyberpunkenergeticsynthesizer