StockTune: Free stock music and songs
StockCake: Free AI stock photosAI Photosuplifting90 bpmnostalgicbackground musicenergeticaward ceremonylofimp3 downloader juice cowmelodic technopunjabi bhangrabig banddsdcinematicjazzfunkworldhappyhindisad beatsdark ambient
Imagine a soundscape that feels like floating through the cosmos, with layers of sound that promote deep relaxation and introspection.
Public DomainAI Generated

Echoes In The Void

Gentle Reverbs For Serene Environments

110 BPMC major02:00

Imagine a soundscape that feels like floating through the cosmos, with layers of sound that promote deep relaxation and introspection.

synthesizerambientadjunctetherealserenereflectivedreamysynthesizersoftetherealmeditationbackgroundsoothingspace

Related Tags

ambientambientetherealetherealreflectivereflectivesoothingsoothingsereneserenemeditationmeditationdreamydreamysoftsoftpeacefulpeacefultranquiltranquilmeditativemeditativerelaxationrelaxation

Similar Stock Music

ethereal sounds mixed with gentle reverberations
ethereal sounds mixed with gentle reverberations
whispers of the nebula
01:43120 BPMD minor
ambientadjunctetherealsynthesizer
ethereal tones float through an airy soundscape
ethereal tones float through an airy soundscape
dreamscapes of silent echoes
01:55150 BPMC major
ambientmuzaketherealsynthesizer
subtle melodies evoke a serene dreamscape
subtle melodies evoke a serene dreamscape
echoes of serenity
01:40145 BPMC major
ambientethereal wavesoothingmusic box
serene tones whisper in a dreamy sequence
serene tones whisper in a dreamy sequence
echoes of silent dreams
01:56135 BPMC major
ambientmuzaketherealsynthesizer
serene music for meditation and relaxation
serene music for meditation and relaxation
echoes in silence
04:00100 BPMC major
ambientambient dubetherealharp
soothing soundscapes for tranquil mental journeys
soothing soundscapes for tranquil mental journeys
whispers of the ether
04:00130 BPMC major
ambientetherealdreamytheremin
ethereal soundscape, dreamy textures, and soothing rhythms
ethereal soundscape, dreamy textures, and soothing rhythms
whispers of distant stars
01:59110 BPMC major
dream popreflectiveetherealelectric piano
extended voyage through stellar dreamscapes
extended voyage through stellar dreamscapes
celestial drift sojourn
01:52105 BPMC major
ambientadjunctetherealsynthesizer
ethereal ambient soundscapes for deep contemplation
ethereal ambient soundscapes for deep contemplation
whispers among stars
04:00120 BPMD major
ambientambient dubetherealharp
ambient adjunct harmonies echo in spaciousness
ambient adjunct harmonies echo in spaciousness
skyward nebula dreams
01:20100 BPMC major
ambientadjunctetherealsynthesizer
ethereal waves meeting tender emotional vibes
ethereal waves meeting tender emotional vibes
whispers of forgotten dreams
01:30120 BPMC major
ethereal waveambientetherealelectric piano
a soundtrack for serene relaxation and reflection
a soundtrack for serene relaxation and reflection
echoes in the mist
04:00130 BPMG major
ambientetherealdreamytheremin
experience serenity with celestial sound textures.
experience serenity with celestial sound textures.
celestial meditative vibes
02:00110 BPMC major
ambienttrippyetherealsynthesizer
ethereal sounds interlace in a dreamy soundscape
ethereal sounds interlace in a dreamy soundscape
whispers of the cosmos
01:57110 BPMG minor
ambientspace musicetherealsynthesizer
light, airily mesmerizing tune evoking dreamy landscapes.
light, airily mesmerizing tune evoking dreamy landscapes.
whispers of ethereal dusk
01:49100 BPMC major
ethereal waveambientetherealharp
ambient electronic journey through ethereal landscapes and distant memories
ambient electronic journey through ethereal landscapes and distant memories
beyond the silent horizon
01:52110 BPMC major
electronicambientdreamysynthesizer
subtle soundscape immersing in celestial tranquility.
subtle soundscape immersing in celestial tranquility.
echoes amongst starlight
01:23120 BPMC major
ethereal waveambientetherealsynthesizer
fluid melodies in a serene auditory journey
fluid melodies in a serene auditory journey
echoes in the dreamscape
01:4590 BPMC major
dream popethereal wavepeacefulelectric piano
perfect for studying or contemplation
perfect for studying or contemplation
echoes in silence
04:00115 BPMC major
ambientminimalistintrospectivepiano
soothing synth melodies for contemplative spaces
soothing synth melodies for contemplative spaces
echoes of quiet moments
01:54120 BPMC major
electropopambient poppeacefulsynthesizer
soothing tones for late night reflection
soothing tones for late night reflection
drifting through cloudscape
01:56140 BPMC major
lofichillwaveetherealelectric piano
ethereal synth lines blend with soft rhythms
ethereal synth lines blend with soft rhythms
whispers of neon dreams
01:55150 BPMC major
synthpopambient synthpopserenesynthesizer
gentle melodies creating a tranquil atmosphere
gentle melodies creating a tranquil atmosphere
breezes of serenity
04:00110 BPMC major
ambientetherealrelaxingflute
a calming melodic experience
a calming melodic experience
gentle waves of harmony
01:51120 BPMC major
ambientetherealcalmingelectric piano
soft tune, peaceful natural scenes.
soft tune, peaceful natural scenes.
breath of nature
04:00120 BPMG major
ambientetherealsoothingflute
ethereal soundscape filled with soothing harmonies.
ethereal soundscape filled with soothing harmonies.
whispers of celestial dreams
01:34155 BPMG major
muzakambientsoothingelectric piano
echoes of ancient voices call softly
echoes of ancient voices call softly
whispers of the past
02:00110 BPMF major
ambientetherealsereneharp
floating through cosmos with soothing melodies.
floating through cosmos with soothing melodies.
dreamy echoes in space
02:00110 BPMC major
easy listeningambientrelaxingelectric piano
gentle cascades of soothing tones envelop you.
gentle cascades of soothing tones envelop you.
echoes in darkness
01:57110 BPMC major
ambientdream popetherealsynthesizer
a soft, dreamy instrumental track that transports the listener to a peaceful state of mind
a soft, dreamy instrumental track that transports the listener to a peaceful state of mind
floating on a cloud
01:58110 BPMA major
ambientchillwavepeacefulpiano
ethereal layers of soothing, dreamlike melodies.
ethereal layers of soothing, dreamlike melodies.
drifting through forgotten dreams
01:49115 BPMC major
ambientethereal ambientdreamyharp
a sonic journey through tranquil sound waves.
a sonic journey through tranquil sound waves.
nightscape dreams unfold
01:57110 BPMF major
ethereal waveambienteuphoricsynthesizer
deep, calming tones in a serene soundscape.
deep, calming tones in a serene soundscape.
whispers in the mist
01:55115 BPMC major
ambientethereal wavemelancholicelectric piano
a soft ambient journey through celestial soundscapes and dreams
a soft ambient journey through celestial soundscapes and dreams
whispers of distant stars
02:0090 BPMF major
ambientspace ambientdreamysynthesizer
serene trance beats, perfect for meditative journeying
serene trance beats, perfect for meditative journeying
tranquil inner journey
01:15135 BPMC major
trancecontemplative trancecontemplativesynthesizer
journey into soothing ethereal soundscapes.
journey into soothing ethereal soundscapes.
echoes in tranquility
01:53170 BPMC major
ethereal waveambientpeacefulsynthesizer
ethereal soundscape, captivating and tender.
ethereal soundscape, captivating and tender.
whispers of a dream
01:57140 BPMC major
ambientethereal wavesentimentalsynthesizer
an instrumental piece weaving serenity and magic under moonlight.
an instrumental piece weaving serenity and magic under moonlight.
whispers under moonlight
01:40110 BPMF major
ambientetherealetherealharp
soothing tones blend with dreamlike synths.
soothing tones blend with dreamlike synths.
whispers of the ether
01:54135 BPMC major
ethereal waveambientpeacefulsynthesizer
ethereal tones meld with soft background sounds
ethereal tones meld with soft background sounds
whispers of serene light
01:5290 BPMF major
ambientethereal waverelaxingelectric piano
embark on a celestial sonic exploration.
embark on a celestial sonic exploration.
stardust echoes
01:55110 BPMC major
ambientspace musicetherealsynthesizer
dreamy sounds meet eccentric textures.
dreamy sounds meet eccentric textures.
stardust melodies whisper
02:00155 BPMC major
ambienteclecticetherealsynthesizer
subtle melodies flow like water, calming the mind
subtle melodies flow like water, calming the mind
echoes beneath leaves
02:29110 BPME major
ambientetherealsereneharp
soft piano calls amidst vast silence
soft piano calls amidst vast silence
whispers across the void
01:58110 BPMC major
ambientethereal wavelongingpiano
soothing tune, perfect for morning relaxation
soothing tune, perfect for morning relaxation
morning light serenity
02:00120 BPMC major
ambientethereal waveheartwarmingsynthesizer
gentle piano melodies, soothing and calm
gentle piano melodies, soothing and calm
whispers of the heart
01:52150 BPMA major
ambientetherealserenepiano
dreamy soundscape floating through cosmic ambience
dreamy soundscape floating through cosmic ambience
whispers in silent space
01:40105 BPMG major
electronicambientetherealsynthesizer
soothing sitar in a dreamy realm
soothing sitar in a dreamy realm
echoes in thoughts
01:50110 BPMC major
psychedelicchillwavedreamysitar
ethereal sounds float through dreamy landscapes.
ethereal sounds float through dreamy landscapes.
whispers of the night
01:27110 BPMD major
ambientdream popetherealsynthesizer
gentle whispers among celestial waves
gentle whispers among celestial waves
stars in silent harmony
02:00155 BPMC major
dream popambient popetherealsynthesizer
gentle melody rises through serene soundscapes.
gentle melody rises through serene soundscapes.
whispers in f major
04:00115 BPMC major
ambientminimalistetherealharp
gentle echoes through a serene landscape
gentle echoes through a serene landscape
whispers of the wind
02:0090 BPMC major
ambientsmooth ambientrelaxingelectric piano
calm zen sounds for relaxation
calm zen sounds for relaxation
whispers of the forest
01:55120 BPMC major
ambientethereal waveserenepiano
ambient soundscapes evoke introspection in this ethereal composition.
ambient soundscapes evoke introspection in this ethereal composition.
echoes of distant dreams
01:50100 BPMC major
ambientethereal wavecontemplativesynthesizer
gentle melodies swirl in surreal calm
gentle melodies swirl in surreal calm
ethereal voices of dawn
01:5590 BPMG major
ambientethereal waveetherealharp
soothing dark sounds with a gentle rhythm
soothing dark sounds with a gentle rhythm
whispers in twilight
01:50100 BPMC major
darkwaveethereal wavetranquilsynthesizer
a serene soundscape
a serene soundscape
eternal echoes soar
01:58110 BPMC major
ambientetherealpeacefulharp
soothing theremin waves over calming landscapes
soothing theremin waves over calming landscapes
skies whisper softly
01:29115 BPMF major
ethereal waveambientserenetheremin
soft ethereal soundscape for peaceful reflection
soft ethereal soundscape for peaceful reflection
gentle dawn reverie
01:50105 BPMBb major
ambientethereal waverelaxingelectric piano
a tranquil soundscape weaving cosmic melodies for introspective moments
a tranquil soundscape weaving cosmic melodies for introspective moments
echoes across the universe
00:03160 BPME major
ambientspace ambientdreamysynthesizer
an intimate sound story
an intimate sound story
velvet shadows calling
02:00120 BPMC major
ambientetherealmelancholyelectric guitar
relaxing melodies for peaceful nights
relaxing melodies for peaceful nights
night sky serenity
02:0090 BPMG major
lofichillwaveetherealelectric piano
elevate to otherworldly relaxation with sonic tranquility
elevate to otherworldly relaxation with sonic tranquility
stardust meditation drift
04:00100 BPMD major
ambientspace age popetherealsynthesizer
serene waves meet celestial dreamscape textures.
serene waves meet celestial dreamscape textures.
dreamscapes of ethereal echoes
01:3080 BPMC major
ambienttrippyetherealsynthesizer
explore the sound of night through ethereal layers
explore the sound of night through ethereal layers
echoes in the darkness
01:49110 BPMD major
ethereal waveambientetherealsynthesizer
a serene journey through ambient soundscapes and reflective tones.
a serene journey through ambient soundscapes and reflective tones.
echoes in silent spaces
01:31140 BPMG major
ambientethereal wavecontemplativesynthesizer
hypnotic beats, ethereal sounds create a surreal atmosphere
hypnotic beats, ethereal sounds create a surreal atmosphere
dreamscape immersive journey
01:55120 BPMC major
ambientethereal waverelaxingsynthesizer
reflective music for deep concentration
reflective music for deep concentration
whispers of the mind
04:00110 BPMBb major
ambientminimalistintrospectivepiano
soothing yet haunting ambient harmony
soothing yet haunting ambient harmony
echoes from the past
02:00110 BPMA major
ambientdark ambientetherealharp
relaxing melodies meet gentle techno vibes
relaxing melodies meet gentle techno vibes
calm techno reverie
01:58110 BPMF major
technoambient technopeacefulsynthesizer
journey across galaxies with soothing ambient soundscapes.
journey across galaxies with soothing ambient soundscapes.
echoes of distant stars
01:5990 BPMBb major
ambientethereal ambientdreamysynthesizer
softly blown leaves on a calm day.
softly blown leaves on a calm day.
breezes in autumn silence
01:54115 BPMC major
ambientadjunctpeacefulflute
peaceful soundscapes for deep relaxation and meditation
peaceful soundscapes for deep relaxation and meditation
ethereal bliss
01:58130 BPMC major
ambientchillwavecalmsynthesizer
soothing, ethereal soundscapes evoke heavenly serenity.
soothing, ethereal soundscapes evoke heavenly serenity.
celestial dreams awaken
01:50100 BPMC major
new ageethereal waverelaxingharp
soft tones echo beneath leafy canopies
soft tones echo beneath leafy canopies
echoes in the woods
01:59110 BPMC major
ambientethereal wavepeacefulflute
a soothing soundscape merging cosmic echoes with tranquil harmonies.
a soothing soundscape merging cosmic echoes with tranquil harmonies.
whispers of celestial light
01:09155 BPMC major
ambientspace ambientenigmaticanalog synthesizer
orchestral harp reverberates through tranquility
orchestral harp reverberates through tranquility
celestial serenade
01:29110 BPMC major
muzakambientdreamyharp
serene soundscape, gentle electronic layers.
serene soundscape, gentle electronic layers.
whispers of the dawn
02:00100 BPMC major
electronicambientpeacefulsynthesizer
soft notes paint peaceful auditory visions.
soft notes paint peaceful auditory visions.
echoes of serenity
04:00120 BPMG major
ambientminimalistetherealharp
gentle piano echoes through stillness
gentle piano echoes through stillness
silence speaks volumes
04:00150 BPMC major
ambientetherealpeacefulpiano
soothing, expansive soundscape of melancholic reflection.
soothing, expansive soundscape of melancholic reflection.
echoes of silent sorrow
01:45145 BPMC major
ambientethereal wavemelancholicelectric piano
ethereal tones under a moonlit sky.
ethereal tones under a moonlit sky.
whispers of the night
04:00110 BPMEb major
ambientdream popdreamyharp
soothing, magical tune echoing nature's serenity
soothing, magical tune echoing nature's serenity
whispers of the forest
01:50170 BPMC major
ambientetherealpeacefulharp
hypnotic patterns, soft tones, ethereal backdrop
hypnotic patterns, soft tones, ethereal backdrop
dreamscape drifters melody
01:50130 BPMD major
ambientambient dubrelaxingharp
a serene soundscape blending ambient tones and ethereal melodies
a serene soundscape blending ambient tones and ethereal melodies
echoes of silent light
01:4875 BPMC major
ambientetherealcalmsynthesizer
gentle ambient soundscape for relaxation
gentle ambient soundscape for relaxation
morning light whisper
01:2290 BPMC major
ambientethereal waveheartwarmingelectric piano
ethereal soundscape invoking serene, uplifting feelings
ethereal soundscape invoking serene, uplifting feelings
clouds over silent hills
00:0390 BPME major
ethereal waveambientserenetheremin
calming tune for relaxation and contemplation
calming tune for relaxation and contemplation
whispers of gentle dreams
04:00110 BPMD major
ambientetherealsoothingharp
lighthearted melodies float on a clear day
lighthearted melodies float on a clear day
skyward soaring dreams
04:00110 BPMD major
ambientchilloutdreamyflute
soothing melody intertwined with nature's breath
soothing melody intertwined with nature's breath
whispers of the forest
02:00120 BPMC major
new ageambientpeacefulflute
experience tranquility through harmonic resonance.
experience tranquility through harmonic resonance.
echoes through trees
03:59120 BPMB major
ambientnature soundspeacefulharp
soft background music for peaceful moments
soft background music for peaceful moments
echoes of silence
04:00140 BPMB major
ambientetherealcontemplativeflute
an ethereal instrumental journey through serene, magical moonlit landscapes.
an ethereal instrumental journey through serene, magical moonlit landscapes.
enchanted moonlit dreams
01:47100 BPMG major
ambientetherealetherealharp
delicate tones carry dreamy, ethereal essence
delicate tones carry dreamy, ethereal essence
whispers of dreamland
01:5785 BPMC minor
ambientethereal wavesoothingmusic box
tranquil celestial reflections craft an otherworldly soothing soundscape.
tranquil celestial reflections craft an otherworldly soothing soundscape.
luminous celestial reflections
01:43100 BPMC major
ethereal wavedream poppeacefulsynthesizer
a soothing harp piece that envelops listeners in tranquility.
a soothing harp piece that envelops listeners in tranquility.
lullaby of distant stars
01:57100 BPMC major
ambientethereal ambientsereneharp
serene synthesizer soundscape for relaxation
serene synthesizer soundscape for relaxation
echoes of the cosmos
01:1690 BPMC major
ambientmuzakmeditativesynthesizer
glimmering essence under starlight.
glimmering essence under starlight.
night sky serenity
01:0775 BPMEb major
ambienteclecticetherealsynthesizer
subtle, haunting melodies over gentle rhythms
subtle, haunting melodies over gentle rhythms
whispers of electric dreams
02:00110 BPMC major
ambientchillwaveetherealelectric piano
soft melody transcends, soothing ethereal vibes bloom
soft melody transcends, soothing ethereal vibes bloom
whispers of the heart
01:55115 BPMC major
rocksoft rockdreamypiano