StockTune: Free stock music and songs
StockCake: Free AI stock photosAI Photosarabic traditionalelevator music90 bpmenergeticupliftingpan flutelofiinstrumental gospelgermantraditional african drumsitar and tablareflectivemoroccanindian classicalegyptianchillwavehappyambient150 bpm100 bpm
Relive the golden days of disco with a vibrant instrumental track featuring energetic synths, lively bass, and compelling percussion. Designed to invoke memories of glittering dance floors and joyous gatherings.
Public DomainAI Generated

Flashback To The Seventies

Rhythmic Grooves That Transport To 1970s Dance Era.

115 BPME minor01:58

Relive the golden days of disco with a vibrant instrumental track featuring energetic synths, lively bass, and compelling percussion. Designed to invoke memories of glittering dance floors and joyous gatherings.

synthesizerdiscoretro disconostalgicgroovyupbeatnostalgiadancingretrodisco1970sfunkysynthsdancefloorbasslines

Related Tags

instrumentalinstrumentalnostalgicnostalgicambientambientreflectivereflectiveenergeticenergeticelectronicelectronicetherealetherealdancedancesynthsynthurbanurbannostalgianostalgiaupliftinguplifting

Similar Stock Music

cheerful melodies infused with retro compelling rhythms
cheerful melodies infused with retro compelling rhythms
disco dreams revival
01:55130 BPMF minor
discoretro discojoyfulsynthesizer
uplifting beats with a nostalgic, hopeful flourish
uplifting beats with a nostalgic, hopeful flourish
reviving hopeful disco vibes
01:44100 BPMC major
discoretro discojoyfulsynthesizer
groovy beats evoking memories of 1970s discotheques.
groovy beats evoking memories of 1970s discotheques.
retro dancefloor memories
01:48120 BPMG major
discoretro disconostalgicsynthesizer
uplifting melodies highlight energetic retro disco dance tracks
uplifting melodies highlight energetic retro disco dance tracks
vintage disco dreams
01:59120 BPMA minor
discoretro disconostalgicsynthesizer
catchy beats with lush nostalgic disco melodies
catchy beats with lush nostalgic disco melodies
retro neon dancefloor
01:37125 BPME minor
discoretro disconostalgicsynthesizer
affectionate retro disco with warm, vintage synthesizer melodies
affectionate retro disco with warm, vintage synthesizer melodies
nostalgic disco groove
01:15105 BPMC major
discoretro disconostalgicsynthesizer
nostalgic and affectionate disco with vintage synth melodies
nostalgic and affectionate disco with vintage synth melodies
retro love groove
01:51125 BPMA minor
discoretro disconostalgicsynthesizer
instrumental disco tune blending sensual rhythms and retro vibes.
instrumental disco tune blending sensual rhythms and retro vibes.
midnight mirage groove
01:43105 BPME minor
disconu discosensualsynthesizer
an instrumental disco track evoking sensuality under shimmering lights.
an instrumental disco track evoking sensuality under shimmering lights.
velvet nights electric dreams
01:48105 BPMD major
disconu discosensualsynthesizer
journey through stars with dreamy synths and disco rhythms
journey through stars with dreamy synths and disco rhythms
stardust dance odyssey
01:58110 BPMC major
discospace discodreamysynthesizer
an ethereal blend of dreamy synths and classic disco beats
an ethereal blend of dreamy synths and classic disco beats
celestial groove voyage
01:58115 BPMB major
discospace discodreamysynthesizer
catchy, danceable tones in a retro style
catchy, danceable tones in a retro style
evening disco rhythms
01:55125 BPMF minor
disconu discoenergeticsynthesizer
vibrant beats set a nostalgic retro tone
vibrant beats set a nostalgic retro tone
twilight groove highway
01:52125 BPMD minor
disconu discoenergeticsynthesizer
a retro disco instrumental that evokes deep nostalgic feelings.
a retro disco instrumental that evokes deep nostalgic feelings.
disco echoes of memory
01:42110 BPMA minor
disconu disconostalgicsynthesizer
a nostalgic disco track filled with deep longing.
a nostalgic disco track filled with deep longing.
lonely disco nightfall
01:39120 BPMA minor
disconu disconostalgicsynthesizer
perfect party music with retro vibes.
perfect party music with retro vibes.
night at the disco
02:43110 BPMC major
disconu discojoyfulsynthesizer
uplifting beats, captivating 70s disco vibes.
uplifting beats, captivating 70s disco vibes.
dance under neon lights
04:00160 BPMB minor
disconu discojoyfulsynthesizer
foreboding melody with chilling retro vibes and synth pulses
foreboding melody with chilling retro vibes and synth pulses
ghostly disco nightmares
01:45120 BPME minor
discodark discoeeriesynthesizer
chilling 1970s inspired eeriness with retro synth pulses
chilling 1970s inspired eeriness with retro synth pulses
haunted disco ball dance
01:50180 BPMD# minor
discodark discoeeriesynthesizer
slow, steady beats for heartfelt solo dance
slow, steady beats for heartfelt solo dance
solitary dance floor
01:5790 BPMA minor
disconu disconostalgicsynthesizer
melancholic electronic beats with shimmering synth overlays
melancholic electronic beats with shimmering synth overlays
lonely disco night
01:37115 BPMG# minor
disconu disconostalgicsynthesizer
emotional, nostalgic disco with subdued melodies and rhythm.
emotional, nostalgic disco with subdued melodies and rhythm.
heartache under mirrorball
01:56125 BPMC minor
discopsychedelic discomelancholicsynthesizer
slow, emotional disco tune with melancholy and retro vibes.
slow, emotional disco tune with melancholy and retro vibes.
moonlit heartbreak dancefloor
01:34100 BPMA minor
discopsychedelic discomelancholicsynthesizer
feel the warmth with every beat
feel the warmth with every beat
golden hour dance
01:23125 BPMC major
discoclassic discojoyfulsynthesizer
euphoric beats meet heartwarming nostalgic melodies
euphoric beats meet heartwarming nostalgic melodies
sunset grooves delight
01:42120 BPMA minor
discoclassic discojoyfulsynthesizer
floating on rhythmic waves under starry skies.
floating on rhythmic waves under starry skies.
cosmic dance reflections
02:00130 BPMF major
discodream discoetherealsynthesizer
dreamy melodies meet groovy disco beats.
dreamy melodies meet groovy disco beats.
stardust under neon lights
01:39115 BPMEb major
discodream discoetherealsynthesizer
an upbeat retro disco instrumental perfect for dancing the night away
an upbeat retro disco instrumental perfect for dancing the night away
shimmering mirror ball nights
01:58125 BPMC major
disconu-discojoyfulsynthesizer
an energetic retro instrumental journey through cosmic disco soundscapes.
an energetic retro instrumental journey through cosmic disco soundscapes.
cosmic dancefloor odyssey
01:51125 BPMG minor
space discocosmic discoeuphoricsynthesizer
euphoric retro instrumental merging cosmic sounds with nostalgic beats.
euphoric retro instrumental merging cosmic sounds with nostalgic beats.
starlight echoes unleashed
01:47130 BPME minor
space discocosmic discoeuphoricsynthesizer
an emotive disco piece fusing retro vibes with heartfelt tunes
an emotive disco piece fusing retro vibes with heartfelt tunes
midnight memories unveiled
01:50125 BPMC major
disconu disconostalgicsynthesizer
an emotional disco track blending nostalgia with modern beats
an emotional disco track blending nostalgia with modern beats
dancing through midnight tears
01:30130 BPMG major
disconu disconostalgicsynthesizer
aliens groove under earth's old disco lights
aliens groove under earth's old disco lights
stellar dance reflections
01:25125 BPMG minor
discospace discoeuphoricsynthesizer
sci fi disco meets retro nostalgia
sci fi disco meets retro nostalgia
moonlit groove on mars
01:51125 BPMC minor
discospace discoeuphoricsynthesizer
disco beats infused with anxious, tense electronic effects
disco beats infused with anxious, tense electronic effects
tense disco dream sequence
01:48115 BPMA minor
disconu discoanxioussynthesizer
disco vibes with underlying tension and anxiety permeation
disco vibes with underlying tension and anxiety permeation
neon nightmares dancefloor anxieties
01:26115 BPMD minor
disconu discoanxioussynthesizer
colorful beats inspire lively celebratory dance atmosphere.
colorful beats inspire lively celebratory dance atmosphere.
retro dance extravaganza
01:55125 BPMC major
discofunk discojoyfulsynthesizer
funky rhythms evoke joyful retro disco party vibes.
funky rhythms evoke joyful retro disco party vibes.
disco groove celebration
01:55115 BPMC major
discofunk discojoyfulsynthesizer
exciting, energetic synths, chaotic retroscape
exciting, energetic synths, chaotic retroscape
neon groove chaos
01:50135 BPME minor
discoexperimental discochaoticsynthesizer
chaotic beats, retro vibes, electrifying synths
chaotic beats, retro vibes, electrifying synths
electric disco pandemonium
01:59130 BPMA minor
discoexperimental discochaoticsynthesizer
floating on rhythmic waves, under starlit skies
floating on rhythmic waves, under starlit skies
celestial discotheque
01:48120 BPMF# minor
discodreamy discoetherealsynthesizer
dreamy beats meet classic disco vibes
dreamy beats meet classic disco vibes
stardust dance floor
01:46115 BPMC major
discodreamy discoetherealsynthesizer
funky synth-driven disco dance track
funky synth-driven disco dance track
electric disco inferno
01:58125 BPMC major
disconu-discocelebratorysynthesizer
a funky space voyage through the stars
a funky space voyage through the stars
cosmic disco odyssey
01:58100 BPMA minor
discospace discodreamysynthesizer
an upbeat disco instrumental perfect for a wild dance party
an upbeat disco instrumental perfect for a wild dance party
glittery disco ball extravaganza
02:00125 BPMF minor
disconu-discoenergeticsynthesizer
high energy dance track, pulsating retro disco beats
high energy dance track, pulsating retro disco beats
electric boogie heatwave
01:48110 BPMC minor
discoretroenergeticsynthesizer
fast paced grooves with infectious retro party energy
fast paced grooves with infectious retro party energy
wild disco night fever
01:31160 BPMC major
discoretroenergeticsynthesizer
synths revive eighties dance magic.
synths revive eighties dance magic.
electric dreams revival
03:36115 BPMEb major
italo discosynthwaveenergeticsynthesizer
gleaming synths meet classic eighties pulse.
gleaming synths meet classic eighties pulse.
retro neon dance night
02:40130 BPMAb major
italo discosynthwaveenergeticsynthesizer
a surreal disco journey blending dreams with dance rhythms
a surreal disco journey blending dreams with dance rhythms
midnight disco reverie
01:44125 BPMC minor
discospace discodreamysynthesizer
a dreamy disco track with ethereal synths and groovy beats
a dreamy disco track with ethereal synths and groovy beats
dancing in midnight dreams
01:54120 BPME minor
discospace discodreamysynthesizer
groovy disco instrumental evoking sentimental memories and dance vibes
groovy disco instrumental evoking sentimental memories and dance vibes
memories under disco lights
01:44115 BPME minor
disconu disconostalgicsynthesizer
a nostalgic disco track evoking memories of love and dance
a nostalgic disco track evoking memories of love and dance
echoes of neon lights
01:43120 BPMB minor
disconu disconostalgicsynthesizer
cosmic synth journey blending nostalgic disco vibe
cosmic synth journey blending nostalgic disco vibe
neon starlight voyager
01:11130 BPMC minor
discospace disconostalgicsynthesizer
groovy, nostalgic journey through spacey architectural soundscapes
groovy, nostalgic journey through spacey architectural soundscapes
astral disco night ride
01:40125 BPMC minor
discospace disconostalgicsynthesizer
**nostalgic dancefloor vibes, evoking warm and emotional memories.**
**nostalgic dancefloor vibes, evoking warm and emotional memories.**
**retro neon dancefloor**
01:55110 BPMC major
**disco****nu disco****nostalgic**synthesizer**
**heartfelt disco groove with a nostalgic atmosphere, perfect for reminiscing.**
**heartfelt disco groove with a nostalgic atmosphere, perfect for reminiscing.**
**midnight nostalgia groove**
02:00110 BPME minor
**disco****nu disco****nostalgic**synthesizer**
electrifying futuristic tunes with vibrant 70s disco flair
electrifying futuristic tunes with vibrant 70s disco flair
future funk dance fusion
01:10120 BPMC major
disconu discogroovysynthesizer
groovy 70s rhythms with futuristic synth undertones
groovy 70s rhythms with futuristic synth undertones
cyber disco utopia vibes
01:56120 BPMC minor
disconu discogroovysynthesizer
funky, bright beats with retro city soundscapes
funky, bright beats with retro city soundscapes
electric groove city beats
01:55130 BPMA minor
discourban discogroovysynthesizer
bright, funky beats with urban and retro vibes
bright, funky beats with urban and retro vibes
city lights disco night
01:50120 BPMC major
discourban discogroovysynthesizer
funky, playful retro disco with vibrant synths and infectious beats
funky, playful retro disco with vibrant synths and infectious beats
neon dancefloor groove
01:47125 BPME minor
disconu discoplayfulsynthesizer
energetic, playful instrumental with funky disco vibes
energetic, playful instrumental with funky disco vibes
dancing neon disco delight
01:44115 BPMC major
disconu discoplayfulsynthesizer
a sparkling, upbeat disco instrumental
a sparkling, upbeat disco instrumental
glittery disco nights
02:00115 BPMA minor
disconu-discojoyfulsynthesizer
an infectious disco funk instrumental that will get everyone on the dance floor
an infectious disco funk instrumental that will get everyone on the dance floor
funky disco fever
02:00135 BPMD minor
discodisco funkcelebratorysynthesizer
an upbeat disco dance track that will ignite the dance floor
an upbeat disco dance track that will ignite the dance floor
midnight disco inferno
01:58115 BPMA minor
disconu-discojoyfulsynthesizer
an energetic disco instrumental perfect for the dance floor
an energetic disco instrumental perfect for the dance floor
midnight disco inferno
01:58120 BPMD minor
disconu-discocelebratorysynthesizer
an upbeat disco instrumental that transports you to a glittery dance floor
an upbeat disco instrumental that transports you to a glittery dance floor
disco fever dream
01:58120 BPMB minor
disconu-discojoyfulsynthesizer
funky beats channel 80s cosmic adventure vibes
funky beats channel 80s cosmic adventure vibes
galactic funk odyssey
01:44120 BPMC major
discospace disconostalgicsynthesizer
funky, spacey beats evoke the 80s' adventurous spirit
funky, spacey beats evoke the 80s' adventurous spirit
retro space disco groove
01:38115 BPMD major
discospace disconostalgicsynthesizer
modern twist on classic disco
modern twist on classic disco
disco lights flashing
01:34120 BPMG major
disconu discoenergeticsynthesizer
vintage vibes meet modern dance floors
vintage vibes meet modern dance floors
neon dreams unfold
01:09120 BPME minor
disconu discoenergeticsynthesizer
a lively and infectious disco instrumental that will get everyone on the dance floor
a lively and infectious disco instrumental that will get everyone on the dance floor
funky disco fever
01:58120 BPMF major
disconu-discoenergeticsynthesizer
a sentimental disco groove recalling nostalgic nights under stars
a sentimental disco groove recalling nostalgic nights under stars
disco nights remembered
01:52115 BPMG major
disconu disconostalgicelectric bass
soulful, nostalgic disco funk groove, evokes memories of lost love
soulful, nostalgic disco funk groove, evokes memories of lost love
moonlit funk nostalgia
01:29120 BPME minor
disconu disconostalgicelectric bass
upbeat, nostalgic disco track with retro heartfelt melodies
upbeat, nostalgic disco track with retro heartfelt melodies
shimmering memories dance
01:40120 BPMC# minor
disconu discojoyfulelectric guitar
uplifting disco beats with nostalgic heartfelt melodies
uplifting disco beats with nostalgic heartfelt melodies
golden sunset dancefloor
01:29120 BPMA minor
disconu discojoyfulelectric guitar
swirling synths meet retro beats
swirling synths meet retro beats
starry reflections on the floor
04:00110 BPMA minor
disconu discodreamysynthesizer
glittering echoes under the disco lights
glittering echoes under the disco lights
midnight dance beneath stars
04:00120 BPMC minor
disconu discodreamysynthesizer
electric disco funk groove
electric disco funk groove
neon nights ahead
01:32130 BPMC major
discospace discojoyfulsynthesizer
a dazzling dance floor anthem
a dazzling dance floor anthem
disco ball dreams
01:58130 BPMC minor
discoglitter discojoyfulsynthesizer
dance under the neon glow, feel the retro vibe
dance under the neon glow, feel the retro vibe
city lights groove
02:46130 BPMF major
italo discoretro futuristicenergeticsynthesizer
energetic beats under starlit disco skies
energetic beats under starlit disco skies
neon nights ride
02:37120 BPMC major
italo discoretro futuristicenergeticsynthesizer
a funky retro dance track perfect for the disco floor
a funky retro dance track perfect for the disco floor
nighttime disco fever
01:58110 BPMF major
disconu-discocelebratorysynthesizer
dance to timeless euphoric rhythm of 70s disco.
dance to timeless euphoric rhythm of 70s disco.
golden disco ecstasy
01:47115 BPMD major
disco70s discoecstaticsynthesizer
boogie down to timeless euphoric 70s disco groove.
boogie down to timeless euphoric 70s disco groove.
disco dreams revisited
01:57130 BPMC major
disco70s discoecstaticsynthesizer
digital synths revitalize classic disco sounds
digital synths revitalize classic disco sounds
electric groove comeback
03:43110 BPMEb major
discoelectro discoenergeticsynthesizer
groovy beats meet futuristic digital synths
groovy beats meet futuristic digital synths
disco nights revival
04:00120 BPMD minor
discoelectro discoenergeticsynthesizer
modern disco track with vintage flair
modern disco track with vintage flair
night grooves unfold
02:54125 BPME major
disconu discojoyfulsynthesizer
retro beats meet modern vibes energetically
retro beats meet modern vibes energetically
disco lights shine bright
04:00120 BPMG# minor
disconu discojoyfulsynthesizer
retro synths and pulsating beats create energetic dance atmosphere
retro synths and pulsating beats create energetic dance atmosphere
galactic disco reverie
01:51140 BPMF minor
synthwavedisconostalgicsynthesizer
retro synths create dreamy, nostalgic dance rhythms, energetic groove
retro synths create dreamy, nostalgic dance rhythms, energetic groove
cosmic synthwave disco dreams
01:51110 BPME minor
synthwavedisconostalgicsynthesizer
energetic disco funk with nostalgic and uplifting melodies.
energetic disco funk with nostalgic and uplifting melodies.
golden era groove
01:53105 BPME minor
discofunkcheerfulsynthesizer
uplifting tune with energetic beats and nostalgic vibes.
uplifting tune with energetic beats and nostalgic vibes.
retro sunburst boogie
01:59125 BPMD minor
discofunkcheerfulsynthesizer
blends retro disco vibes with modern smooth sounds, night groove
blends retro disco vibes with modern smooth sounds, night groove
rhythmic night cityscape
01:29120 BPMA minor
discofunkgroovysynthesizer
smooth beats with disco funk vibes, perfect dance track
smooth beats with disco funk vibes, perfect dance track
groove under neon lights
01:40120 BPMC major
discofunkgroovysynthesizer
deep thoughts swirling on danceable waves
deep thoughts swirling on danceable waves
reflections in rhythm
04:00120 BPMD major
discoambient discoreflectivesynthesizer
reflective beats meet vibrant dance floors
reflective beats meet vibrant dance floors
dreams under disco lights
04:00125 BPMC major
discoambient discoreflectivesynthesizer
energetic beats meet nostalgic disco grooves.
energetic beats meet nostalgic disco grooves.
neon dreams await
02:0095 BPMA minor
synthwavediscoenergeticsynthesizer
creepy retro disco sound with eerie synth melodies
creepy retro disco sound with eerie synth melodies
midnight boogie menace
01:48125 BPME minor
discodark discoominoussynthesizer