StockTune: Free stock music and songs
StockCake: Free AI stock photosAI Photosdancepopsymphonic metalelevator musicpeacefulpianochilloutdark ambientmysteriousvictory anthemambient nature sound scaper elaxing flutearabic traditionalupliftingsports musichard technospooky funk180 bpmelectric guitarjoyfultechno
An instrumental synthwave track that takes listeners back to the neon soaked streets of the 80s, evoking nostalgic memories of night drives and city lights.
Public DomainAI Generated

Memories Of Neon Nights

Nostalgic Synthwave Journey Through Neon Lit Memories, Purely Instrumental

125 BPMA minor01:36

An instrumental synthwave track that takes listeners back to the neon soaked streets of the 80s, evoking nostalgic memories of night drives and city lights.

synthesizersynthwavedreamwavenostalgicdreamymelancholicinstrumentalnostalgic80sneonretroelectronicnight drive

Related Tags

instrumentalinstrumentalnostalgicnostalgicambientambientreflectivereflectiveelectronicelectronicenergeticenergeticetherealetherealsynthsynthurbanurbannostalgianostalgiadancedancedreamydreamyneonneon

Similar Stock Music

a synth driven instrumental echoing the emotions of the 80s
a synth driven instrumental echoing the emotions of the 80s
echoes in time
01:32115 BPMF major
synthwavedreamwavenostalgicsynthesizer
an emotional instrumental journey through longing and reminiscence
an emotional instrumental journey through longing and reminiscence
shadows fade away
01:5690 BPMC major
synthwavedreamwavenostalgicsynthesizer
an instrumental synth track reflecting on 80s memories
an instrumental synth track reflecting on 80s memories
echoes in neon lights
01:44100 BPMD major
synthwavedreamwavenostalgicsynthesizer
instrumental 80s synth journey through memories and nostalgic dreams
instrumental 80s synth journey through memories and nostalgic dreams
neon dreams revisited
01:3980 BPMC major
synthwavedreamwavenostalgicsynthesizer
a yearning synthwave piece reflecting on lost moments and love
a yearning synthwave piece reflecting on lost moments and love
memories in neon lights
01:5690 BPMF major
synthwavedreamwavenostalgicsynthesizer
a nostalgic synthwave track evoking memories of a lost past
a nostalgic synthwave track evoking memories of a lost past
neon dreams fade away
01:4585 BPMC major
synthwavedreamwavenostalgicsynthesizer
a melodic synth odyssey through ethereal, nostalgic landscapes
a melodic synth odyssey through ethereal, nostalgic landscapes
starlit neon visions
01:52120 BPMC major
synthwavedreamwavenostalgicsynthesizer
an atmospheric journey through nostalgic, synth laden soundscapes
an atmospheric journey through nostalgic, synth laden soundscapes
echoes of neon dreams
01:2480 BPMC major
synthwavedreamwavenostalgicsynthesizer
an instrumental blending mystical ambiance with retro synth textures
an instrumental blending mystical ambiance with retro synth textures
enchanted retro melodies
01:59115 BPMF major
synthwavedreamwavedreamysynthesizer
an instrumental blending mystical melodies with retro synth grooves
an instrumental blending mystical melodies with retro synth grooves
mystic echoes rewind
02:0090 BPMC minor
synthwavedreamwavedreamysynthesizer
an instrumental fusion of ethereal sounds and retro synth vibes
an instrumental fusion of ethereal sounds and retro synth vibes
visions of neon nights
01:43115 BPMD major
synthwavedreamwavenostalgicsynthesizer
an ethereal retro instrumental journey through nostalgic synth soundscapes
an ethereal retro instrumental journey through nostalgic synth soundscapes
echoes of neon dreams
02:0095 BPMC major
synthwavedreamwavenostalgicsynthesizer
a motivating 80s synth journey that inspires with nostalgia
a motivating 80s synth journey that inspires with nostalgia
neon horizons rise
01:4490 BPME minor
synthwavedreamwavehopefulsynthesizer
an uplifting synthwave journey through nostalgic 80s soundscapes
an uplifting synthwave journey through nostalgic 80s soundscapes
echoes of neon dreams
01:40115 BPMD major
synthwavedreamwavehopefulsynthesizer
emotional synthwave track evoking warm, nostalgic feelings and memories.
emotional synthwave track evoking warm, nostalgic feelings and memories.
memories in neon
01:48115 BPMC major
synthwavedreamwavenostalgicsynthesizer
heartwarming synthwave track evoking nostalgic memories and warm feelings.
heartwarming synthwave track evoking nostalgic memories and warm feelings.
neon dreams awake
01:43100 BPMG major
synthwavedreamwavenostalgicsynthesizer
an instrumental synthwave track capturing nostalgic longing for past times
an instrumental synthwave track capturing nostalgic longing for past times
neon dreams of yesterday
01:42160 BPMA minor
synthwavedreamwavemelancholicsynthesizer
a synthwave track yearning for bygone days and memories
a synthwave track yearning for bygone days and memories
echoes of lost time
01:46105 BPMC minor
synthwavedreamwavemelancholicsynthesizer
gleaming retro synthwave with dreamy soothing lush pads
gleaming retro synthwave with dreamy soothing lush pads
retro twilight dream sequence
01:3590 BPMC major
synthwavedreamwavenostalgicsynthesizer
nostalgic melody with mellow, dreamy and retro vibes
nostalgic melody with mellow, dreamy and retro vibes
golden era midnight daydream
01:55100 BPMG major
synthwavedreamwavenostalgicsynthesizer
an ambient journey exploring solitude in neon lit urban landscapes
an ambient journey exploring solitude in neon lit urban landscapes
solitude among neon streets
02:00100 BPMA major
synthwavedreamwaveintrospectivesynthesizer
an introspective synthwave journey through neon lit urban solitude
an introspective synthwave journey through neon lit urban solitude
echoes beneath neon skies
01:21120 BPMC major
synthwavedreamwaveintrospectivesynthesizer
a mystical synthwave track exploring cosmic realms and neon lights
a mystical synthwave track exploring cosmic realms and neon lights
celestial synthwave voyage
02:0095 BPMF major
synthwavedreamwavedreamysynthesizer
mystical synthwave journey through cosmic neon dreams and shadows
mystical synthwave journey through cosmic neon dreams and shadows
echoes in cosmic night
01:39120 BPME minor
synthwavedreamwavedreamysynthesizer
a moving synthwave piece reflecting on deep emotions and nostalgia
a moving synthwave piece reflecting on deep emotions and nostalgia
shadows beneath neon skies
01:33105 BPMC major
synthwavedreamwavenostalgicsynthesizer
an emotional synthwave journey through lost love and memories
an emotional synthwave journey through lost love and memories
echoes of neon hearts
01:52150 BPMC major
synthwavedreamwavenostalgicsynthesizer
an uplifting track fusing retro synths with hopeful melodies.
an uplifting track fusing retro synths with hopeful melodies.
echoes of neon nights
01:3395 BPMC major
synthwavedreamwavenostalgicsynthesizer
an instrumental blending retro synths with hopeful melodies.
an instrumental blending retro synths with hopeful melodies.
dreams of neon nights
01:56115 BPMDb major
synthwavedreamwavenostalgicsynthesizer
soft synthwave soundscapes capturing tender moments under neon skies.
soft synthwave soundscapes capturing tender moments under neon skies.
midnight echoes of love
01:40100 BPMBb major
synthwavedreamwavenostalgicsynthesizer
a tender synthwave journey through nostalgic neon lit nights.
a tender synthwave journey through nostalgic neon lit nights.
whispers under neon skies
01:39100 BPMD major
synthwavedreamwavenostalgicsynthesizer
smoothly floating through luminous, serene dreamscapes of synth sounds.
smoothly floating through luminous, serene dreamscapes of synth sounds.
luminous night journey
01:52115 BPMG major
synthwavedreamwaverelaxingsynthesizer
calmly drifting through a neon lit dreamland ambiance.
calmly drifting through a neon lit dreamland ambiance.
neon tranquil escape
01:19130 BPMC major
synthwavedreamwaverelaxingsynthesizer
emotional synth waves that evoke heartfelt memories at twilight
emotional synth waves that evoke heartfelt memories at twilight
twilight synth love
01:4185 BPMC major
synthwavedreamwavenostalgicsynthesizer
warm, nostalgic synths painting twilight memories with tenderness
warm, nostalgic synths painting twilight memories with tenderness
dusk neon embrace
01:45110 BPMF major
synthwavedreamwavenostalgicsynthesizer
shimmering synths evoke nostalgic, dreamy 80s soundscapes
shimmering synths evoke nostalgic, dreamy 80s soundscapes
retro neon horizon
01:45165 BPMC minor
synthwavedreamwavedreamlikesynthesizer
retro synths float over nostalgic, ethereal soundscapes
retro synths float over nostalgic, ethereal soundscapes
neon dreamscape reverie
01:4695 BPMC major
synthwavedreamwavedreamlikesynthesizer
an atmospheric synthwave journey through nostalgic neon lit nights
an atmospheric synthwave journey through nostalgic neon lit nights
echoes of neon dreams
01:48125 BPMC major
synthwavedreamwavedreamysynthesizer
a dreamy synthwave instrumental exploring nostalgic neon lit cityscapes
a dreamy synthwave instrumental exploring nostalgic neon lit cityscapes
neon twilight overdrive
01:21115 BPMA minor
synthwavedreamwavedreamysynthesizer
a journey through dreamy synths and neon drenched city nights
a journey through dreamy synths and neon drenched city nights
starlit neon horizons
01:56100 BPMBb minor
synthwavedreamwavenostalgicsynthesizer
a dreamy synthwave journey through neon lit cityscapes at dusk
a dreamy synthwave journey through neon lit cityscapes at dusk
neon dreams at dusk
01:3285 BPMC major
synthwavedreamwavenostalgicsynthesizer
an intimate synthwave journey through warm nostalgic soundscapes.
an intimate synthwave journey through warm nostalgic soundscapes.
embracing neon dreams
01:4585 BPMF major
synthwavedreamwaveintrospectivesynthesizer
a nostalgic journey through intimate synth layers.
a nostalgic journey through intimate synth layers.
neon nights embrace
01:23165 BPMC major
synthwavedreamwaveintrospectivesynthesizer
a gentle synthwave track capturing intimate neon lit nights.
a gentle synthwave track capturing intimate neon lit nights.
neon dreams unveiled
01:49150 BPMC major
synthwavedreamwavedreamysynthesizer
an intimate synthwave journey through midnight neon lit memories.
an intimate synthwave journey through midnight neon lit memories.
whispers under neon skies
01:5480 BPMF major
synthwavedreamwavedreamysynthesizer
a soothing synthwave piece blending nostalgia and calming synths
a soothing synthwave piece blending nostalgia and calming synths
midnight neon serenity
01:54100 BPMD minor
synthwavedreamwaveserenesynthesizer
a tranquil synthwave track evoking nostalgia and futuristic serenity
a tranquil synthwave track evoking nostalgia and futuristic serenity
beneath neon lit skies
01:18115 BPMC major
synthwavedreamwaveserenesynthesizer
synth infused 80s soundscape evoking dreamlike and nostalgic atmospheres
synth infused 80s soundscape evoking dreamlike and nostalgic atmospheres
neon skyline visions
01:5390 BPMF minor
synthwavedreamwavedreamysynthesizer
dream like 80s synth based atmospheric instrumental track
dream like 80s synth based atmospheric instrumental track
midnight neon reverie
01:20100 BPMC major
synthwavedreamwavedreamysynthesizer
a haunting synthwave journey evoking nostalgia and lost memories
a haunting synthwave journey evoking nostalgia and lost memories
midnight's neon tears
01:54170 BPMG minor
synthwavedreamwavemelancholicsynthesizer
melancholic synthwave journey through lost memories and neon nights
melancholic synthwave journey through lost memories and neon nights
whispers of neon rain
01:2890 BPMBb major
synthwavedreamwavemelancholicsynthesizer
elevating synth melodies inspire optimism and embrace future possibilities
elevating synth melodies inspire optimism and embrace future possibilities
echoes of new dawn
01:57100 BPMC major
synthwavedreamwaveupliftingsynthesizer
an uplifting synthwave journey towards a bright and hopeful tomorrow
an uplifting synthwave journey towards a bright and hopeful tomorrow
radiant future horizon
01:5690 BPMC major
synthwavedreamwaveupliftingsynthesizer
atmospheric synth melodies evoking deep 80s nostalgia
atmospheric synth melodies evoking deep 80s nostalgia
lost in neon dreams
01:4490 BPMA minor
synthwavedreamwavenostalgicsynthesizer
synth driven melody capturing nostalgic yearning of the 80s
synth driven melody capturing nostalgic yearning of the 80s
echoes of distant memories
01:34120 BPME minor
synthwavedreamwavenostalgicsynthesizer
an ambient synthwave track evoking dreamy futuristic cityscapes
an ambient synthwave track evoking dreamy futuristic cityscapes
neon skyline reverie
01:52120 BPMC major
synthwavedreamwavenostalgicsynthesizer
dreamy synthwave journey through neon lit midnight city streets
dreamy synthwave journey through neon lit midnight city streets
midnight neon dreams
01:58170 BPMC minor
synthwavedreamwavenostalgicsynthesizer
a dreamy synthwave soundscape evoking nocturnal neon city wanderings
a dreamy synthwave soundscape evoking nocturnal neon city wanderings
whispers of neon dreams
01:4590 BPMEb major
synthwavedreamwavedreamysynthesizer
a dreamy synthwave instrumental journey through neon lit streets
a dreamy synthwave instrumental journey through neon lit streets
dreams under neon lights
01:2985 BPMA minor
synthwavedreamwavedreamysynthesizer
an optimistic synthwave journey through neon lit future worlds
an optimistic synthwave journey through neon lit future worlds
dreams in neon lights
01:56130 BPMC major
synthwavedreamwavehopefulsynthesizer
an uplifting synthwave track blending hope with neon dreams
an uplifting synthwave track blending hope with neon dreams
hope in neon skies
01:43110 BPMC major
synthwavedreamwavehopefulsynthesizer
an ambient synthwave track evoking memories under neon skies.
an ambient synthwave track evoking memories under neon skies.
whispers of neon nights
01:3690 BPMA minor
synthwavedreamwavenostalgicsynthesizer
a reflective synthwave journey through nostalgic neon lit cityscapes.
a reflective synthwave journey through nostalgic neon lit cityscapes.
reflections in neon rain
01:5890 BPMDb major
synthwavedreamwavenostalgicsynthesizer
vibrant synthwaves evoking trippy, immersive journeys through time.
vibrant synthwaves evoking trippy, immersive journeys through time.
psychedelic neon voyage
01:5085 BPMF major
synthwavedreamwavetrippysynthesizer
retro synths creating psychedelic auditory landscapes, truly immersive.
retro synths creating psychedelic auditory landscapes, truly immersive.
neon dreamwave journey
01:2490 BPMG# minor
synthwavedreamwavetrippysynthesizer
an ethereal journey in neon lit cybernetic digital dreamscapes.
an ethereal journey in neon lit cybernetic digital dreamscapes.
echoes of digital twilight
01:14120 BPMC major
synthwavedreamwavedreamysynthesizer
an ethereal journey through futuristic neon lit cyberpunk landscapes.
an ethereal journey through futuristic neon lit cyberpunk landscapes.
dreams in neon skies
01:5490 BPMC major
synthwavedreamwavedreamysynthesizer
an uplifting synth journey through euphoric, neon drenched landscapes.
an uplifting synth journey through euphoric, neon drenched landscapes.
euphoria under neon lights
02:0090 BPMF# major
synthwavedreamwaveeuphoricsynthesizer
an epic journey through futuristic landscapes of synthesized bliss.
an epic journey through futuristic landscapes of synthesized bliss.
neon skies ascending
01:52100 BPMG major
synthwavedreamwaveeuphoricsynthesizer
instrumental synthwave track evoking warmth and nostalgia under neon lights
instrumental synthwave track evoking warmth and nostalgia under neon lights
embrace the neon glow
01:46100 BPMD major
synthwavedreamwavenostalgicsynthesizer
warm synthwave journey through memories and glowing city lights
warm synthwave journey through memories and glowing city lights
memories in neon glow
01:5090 BPMF major
synthwavedreamwavenostalgicsynthesizer
perfect for reflective late night journeys.
perfect for reflective late night journeys.
city lights reflections
01:4695 BPMAb major
synthwavedreamwaveetherealsynthesizer
the perfect track for nighttime driving reflection.
the perfect track for nighttime driving reflection.
neon nightscape visions
02:0090 BPMC major
synthwavedreamwaveetherealsynthesizer
a nostalgic tune invoking memories and the ache of longing
a nostalgic tune invoking memories and the ache of longing
whispers of the past
01:4385 BPMA minor
synthwavedreamwavenostalgicelectric guitar
ethereal melodies evoke longing for bygone eras and lost love
ethereal melodies evoke longing for bygone eras and lost love
echoes of lost time
01:43100 BPMC major
synthwavedreamwavenostalgicelectric guitar
lush synths paint a nostalgic journey through night skies
lush synths paint a nostalgic journey through night skies
echoes of neon dreams
01:4990 BPMF# major
synthwavedreamwavenostalgicsynthesizer
a dreamy voyage through nostalgic synth landscapes of 80s
a dreamy voyage through nostalgic synth landscapes of 80s
neon skyline memories
01:52155 BPME minor
synthwavedreamwavenostalgicsynthesizer
enigmatic synth melodies creating nighttime urban wonder
enigmatic synth melodies creating nighttime urban wonder
ethereal city lights
01:5890 BPMA minor
synthpopdreamwavenostalgicsynthesizer
dreamy, retro synths evoking a nighttime cityscape journey
dreamy, retro synths evoking a nighttime cityscape journey
starlit midnight escape
01:53105 BPMF major
synthpopdreamwavenostalgicsynthesizer
dreamy synthesizer driven instrumental capturing 80s nostalgia.
dreamy synthesizer driven instrumental capturing 80s nostalgia.
starlit synthwave nostalgia
01:59105 BPMC major
synthwavedreamwavenostalgicsynthesizer
ethereal 80s instrumental with dreamy nostalgic undertones.
ethereal 80s instrumental with dreamy nostalgic undertones.
neon dreams and starlight
01:3090 BPMC major
synthwavedreamwavenostalgicsynthesizer
vibrant electronic sounds building towards an uplifting hopeful climax
vibrant electronic sounds building towards an uplifting hopeful climax
journey towards new horizons
01:4890 BPMF major
synthwavedreamwavehopefulsynthesizer
uplifting synth harmonies guide us into a hopeful tomorrow
uplifting synth harmonies guide us into a hopeful tomorrow
embracing tomorrow's brightness
01:27100 BPMBb major
synthwavedreamwavehopefulsynthesizer
a magical instrumental piece inspiring confidence through enchanting melodies
a magical instrumental piece inspiring confidence through enchanting melodies
enchanted bravery unleashed
01:55100 BPMF major
synthwavedreamwaveempoweredsynthesizer
empowering instrumental piece fusing confident rhythms with magical tones
empowering instrumental piece fusing confident rhythms with magical tones
mystic confidence unveiled
01:51120 BPMD minor
synthwavedreamwaveempoweredsynthesizer
ethereal melodies meet cybernetic rhythms in a neon lit odyssey
ethereal melodies meet cybernetic rhythms in a neon lit odyssey
ascension of neon dreams
01:52100 BPMC major
synthwavedreamwaveetherealsynthesizer
an ethereal journey through a futuristic cyberpunk neon cityscape
an ethereal journey through a futuristic cyberpunk neon cityscape
echoing neon dreams
01:1390 BPMC major
synthwavedreamwaveetherealsynthesizer
a brooding instrumental merging dark synths with sparkling melodies.
a brooding instrumental merging dark synths with sparkling melodies.
echoes in glittering shadows
01:55130 BPMF# minor
synthwavedreamwavebroodingsynthesizer
dark, brooding tones meet sparkling synths in this instrumental piece.
dark, brooding tones meet sparkling synths in this instrumental piece.
glitter in the abyss
02:0095 BPMB major
synthwavedreamwavebroodingsynthesizer
a glowing instrumental piece that illuminates hope and ambition.
a glowing instrumental piece that illuminates hope and ambition.
sparkling dreams arise
01:26120 BPMC major
synthwavedreamwaveupliftingsynthesizer
an uplifting instrumental shimmering with hope and sparkling melodies.
an uplifting instrumental shimmering with hope and sparkling melodies.
glittering hearts ascend
01:2595 BPMA minor
synthwavedreamwaveupliftingsynthesizer
an ethereal synthwave odyssey through neon lit cosmic realms
an ethereal synthwave odyssey through neon lit cosmic realms
voyage through neon dreams
02:00100 BPMD major
synthwavedreamwavedreamysynthesizer
experience an ethereal synthwave voyage through luminous neon skies
experience an ethereal synthwave voyage through luminous neon skies
echoes of neon skies
02:00170 BPMC minor
synthwavedreamwavedreamysynthesizer
an immersive synth soundscape journey through neon lit cosmic vistas.
an immersive synth soundscape journey through neon lit cosmic vistas.
neon skyline night voyage
02:0095 BPMF major
synthwavedreamwavedreamysynthesizer
a trippy journey through space with nostalgic synth melodies.
a trippy journey through space with nostalgic synth melodies.
cosmic synthwave mind voyage
01:27110 BPME minor
synthwavedreamwavedreamysynthesizer
instrumental synthwave track reliving 80s neon nostalgia and memories
instrumental synthwave track reliving 80s neon nostalgia and memories
echoes of neon lights
01:5390 BPMG major
synthwavedreamwavenostalgicsynthesizer
nostalgic synthwave instrumental capturing wistful 80s neon night vibes
nostalgic synthwave instrumental capturing wistful 80s neon night vibes
lost in neon dreams
01:38110 BPMC major
synthwavedreamwavenostalgicsynthesizer
subdued synths evoke midnight reflections in a glittering soundscape
subdued synths evoke midnight reflections in a glittering soundscape
lonely midnight reflections
01:47110 BPMD minor
synthwavedreamwavemelancholicsynthesizer
glistening melancholic themes, evoking deep night reflections
glistening melancholic themes, evoking deep night reflections
glitter tears at midnight
01:5495 BPMF major
synthwavedreamwavemelancholicsynthesizer
retro synths weave hypnotic patterns evoking dreamy 80s nostalgia
retro synths weave hypnotic patterns evoking dreamy 80s nostalgia
neon dreams revisited
01:58120 BPMC minor
synthwavedreamwavehypnoticsynthesizer
a hypnotic journey through 80s synth sounds and retro rhythms
a hypnotic journey through 80s synth sounds and retro rhythms
echoes of neon nights
01:5795 BPMC minor
synthwavedreamwavehypnoticsynthesizer