StockTune: Free stock music and songs
StockCake: Free AI stock photosAI Photosdramatic synth poptempleenergeticpeacefulpianooudelectric guitarnostalgicanime instrumentalfolkchillwavepunjabi folksmooth jazzclassical90 bpmxxxxxxxxl size cxx clothing xx band mp3epicphonkhappyharp
Pulsating synthwave track, harnessing vintage analog synths, heart pounding basslines, and haunting melodies. Builds tension, reminiscent of 80s thrillers with modern production elements. Perfect for suspense or sci fi scenes.
Public DomainAI Generated

Neon Night Encounter

Dark, Pulsating Rhythms Evoke Eerie, Enigmatic Night Chase

90 BPME minor01:58

Pulsating synthwave track, harnessing vintage analog synths, heart pounding basslines, and haunting melodies. Builds tension, reminiscent of 80s thrillers with modern production elements. Perfect for suspense or sci fi scenes.

synthesizersynthwavedark synthwavemysterioustenseeeriesuspensesynthwavevintagedarktensionnightchase80sanalog

Related Tags

synthwavesynthwavesuspensesuspense80s80seerieeerieneonneondarkwavedarkwavedarkdarkretroretronightnighttensiontensionchasechasethrillerthrillersynthsynthelectronicelectronic

Similar Stock Music

pulsating basslines, haunting synths create tense night atmosphere
pulsating basslines, haunting synths create tense night atmosphere
chasing through shadows
01:35115 BPMD minor
synthwavedark synthwavemysterioussynthesizer
sinister vibes dominate the urban night
sinister vibes dominate the urban night
nocturnal neon reflections
01:48100 BPMC minor
synthwavedarkwavesinistersynthesizer
dark, brooding synth beats fill the air
dark, brooding synth beats fill the air
shadowed streets at midnight
02:00100 BPMG minor
synthwavedarkwavesinistersynthesizer
dark synths evoke menacing, nocturnal atmosphere
dark synths evoke menacing, nocturnal atmosphere
shadows creep silent night
01:50150 BPMC minor
electronicdarkwaveominoussynthesizer
eerie synths create unnerving, dark 80s instrumental piece
eerie synths create unnerving, dark 80s instrumental piece
neon shadows haunting darkness
01:41115 BPMC minor
electronicadarkwaveunnervingsynthesizer
suspense builds in synth driven melody
suspense builds in synth driven melody
shadows on neon streets
01:47120 BPMD minor
synthwavedarkwavesuspensefulsynthesizer
haunting pads evoke dark, unnerving 80s instrumental piece
haunting pads evoke dark, unnerving 80s instrumental piece
echoes of neon shadows
01:21115 BPMG minor
electronicadarkwaveunnervingsynthesizer
dark synth waves evoke haunted moments
dark synth waves evoke haunted moments
shadows of neon dreams
01:26110 BPME minor
synthwavedarkwavebroodingsynthesizer
chase through glowing cityscapes
chase through glowing cityscapes
neon night pursuit
01:5295 BPMA minor
synthwavedarkwavesuspensefulsynthesizer
anxiety wrapped in a synth melody
anxiety wrapped in a synth melody
midnight neon shadows
01:5795 BPMC minor
synthwavedarkwaveanxioussynthesizer
sinister synths cloak the city's edges
sinister synths cloak the city's edges
echoes in twilight city
02:00110 BPMD minor
synthwavedarkwavebroodingsynthesizer
pulsating beats under a moonlit sky
pulsating beats under a moonlit sky
shadow chase at midnight
01:53110 BPMC minor
synthwavedark synthwavesinistersynthesizer
venture into the dark, suspense thickens
venture into the dark, suspense thickens
midnight shadows linger
01:2095 BPMD minor
synthwavedarkwavemenacingsynthesizer
retrofuturistic soundscape blending anxious undertones and electric riffs.
retrofuturistic soundscape blending anxious undertones and electric riffs.
restless neon echoes
01:4290 BPMA minor
synthwaveretroanxiouselectric guitar
rhythms twist under moonlit chills
rhythms twist under moonlit chills
shadows of the night
01:15100 BPMD# minor
synthwavedarkwavesinistersynthesizer
chilling echoes in moonlit alleys
chilling echoes in moonlit alleys
dark city whispers
01:0895 BPMC# minor
synthwavedarkwaveominoussynthesizer
sinister synths meet chilling night ambiance
sinister synths meet chilling night ambiance
night shadows creep in
01:5995 BPMF minor
synthwavedarkwavesinistersynthesizer
synthwave track with pulsating beats and suspenseful atmosphere
synthwave track with pulsating beats and suspenseful atmosphere
midnight neon chase
01:3990 BPMA minor
synthwavedarkwavesuspensefulsynthesizer
retro horror synth evokes suspenseful and eerie atmosphere.
retro horror synth evokes suspenseful and eerie atmosphere.
haunted synthwave manor
01:5585 BPMC minor
synthwavedarkwaveominoussynthesizer
synths illuminate eerie, dark landscapes
synths illuminate eerie, dark landscapes
moonlight fear symphony
02:00150 BPMC major
electronicdarkwaveominoussynthesizer
energetic throwback full of nostalgic synths.
energetic throwback full of nostalgic synths.
midnight pursuit flashback
02:0090 BPMA minor
synthwavedarkwavetensesynthesizer
pulse of the anxious night
pulse of the anxious night
city after dark
01:39100 BPMC# minor
synthwavedarkwaveanxioussynthesizer
ominous tones over pulsating synth melodies create tension.
ominous tones over pulsating synth melodies create tension.
haunting neon shadows
01:5390 BPMD minor
synthpopdarkwavebroodingsynthesizer
a cinematic journey evoking tense emotion through retro sounds.
a cinematic journey evoking tense emotion through retro sounds.
eighty's dark secrets
01:5090 BPME minor
synthwaveretromysterioussynthesizer
eerie synth pads hover over pulsating beats
eerie synth pads hover over pulsating beats
whispers through neon
04:00115 BPME minor
synthwavedarkwavemysterioussynthesizer
mysterious, suspenseful synthpop with dark undertones and intensity.
mysterious, suspenseful synthpop with dark undertones and intensity.
neon shadows rising
01:35120 BPME minor
synthpopdarkwavemysterioussynthesizer
tense 80s synthwave chase across neon cityscape
tense 80s synthwave chase across neon cityscape
neon nighttime pursuit
01:18115 BPMC minor
synthwaveretro 80stensesynthesizer
eerie synths build over trembling bass drops
eerie synths build over trembling bass drops
shadows creep at night
01:53140 BPMC# minor
dubstepdarkwaveanxioussynthesizer
melody haunts, bass reverberates in darkness
melody haunts, bass reverberates in darkness
night's whisper of fear
02:5290 BPMC minor
horror synthcinematic horrorcreepysynthesizer
synth heavy track with pulsating beats.
synth heavy track with pulsating beats.
night chase neon lights
01:24100 BPMF minor
synthwavedarkwavetensesynthesizer
grittier 80s sound with brooding synths
grittier 80s sound with brooding synths
streets of neon night
01:3890 BPMD minor
synthwavedarkwavemysteriouselectric guitar
a tense instrumental weaving retro synths and pulsing beats
a tense instrumental weaving retro synths and pulsing beats
shadows in neon lights
01:58115 BPMG# minor
synthwavedark synthtensesynthesizer
haunting synths play menacingly under the stars
haunting synths play menacingly under the stars
moonlit pursuit echoes
01:59135 BPMA minor
synthwavedark synthwavesinistersynthesizer
echoes linger in misty uncertainty
echoes linger in misty uncertainty
midnight whisper warning
01:5590 BPMC minor
chillwavedarkwaveominoussynthesizer
heart pounding rhythm driving a high speed pursuit.
heart pounding rhythm driving a high speed pursuit.
midnight chase scene
01:48105 BPMA minor
synthwavecinematic synthwaveaggressivesynthesizer
dark 80s synth pop with eerie undertones
dark 80s synth pop with eerie undertones
neon shadows emerge
01:4695 BPME minor
synth popdarkwavemenacingsynthesizer
intense synthwave with urgent, pulsating beats and suspense
intense synthwave with urgent, pulsating beats and suspense
neon streets pursuit
01:48120 BPMA minor
synthwavedarkwavesuspensefulsynthesizer
intense dark vibes with suspenseful undertones
intense dark vibes with suspenseful undertones
shadows creep at midnight
02:00180 BPMA minor
synthwavedarkwavemenacingsynthesizer
moody synths swirl in dark rhythms
moody synths swirl in dark rhythms
echoes in the dark
04:00130 BPMA minor
synthwavedarkwavemysterioussynthesizer
pulsating disco track mixed with a sense of tension.
pulsating disco track mixed with a sense of tension.
mystery under mirror ball
01:2485 BPMA minor
discosuspensesuspensefulsynthesizer
high adrenaline pursuit through a cyberpunk city.
high adrenaline pursuit through a cyberpunk city.
night chase neon fear
01:33110 BPMF minor
electronicsynthwavetensesynthesizer
creepy, funky bassline in mysterious urban nightscape.
creepy, funky bassline in mysterious urban nightscape.
midnight alley groove
00:5990 BPMA minor
funkurban funkgroovybass guitar
rapid beats giving sense of urgency and danger.
rapid beats giving sense of urgency and danger.
night time chase
01:53110 BPMG# minor
synthwavecinematic synthwaveaggressivesynthesizer
pulsating synths driving anxious nocturnal atmosphere with urgency.
pulsating synths driving anxious nocturnal atmosphere with urgency.
synthetic midnight anxiety
01:48120 BPMC minor
electronicsynthwaveanxioussynthesizer
suspense builds in creeping, enveloping layers
suspense builds in creeping, enveloping layers
chase through misty shadows
01:5090 BPME minor
rockprogressive rockthrillingelectric guitar
menacing grooves meet smooth transitions.
menacing grooves meet smooth transitions.
shadows in the alley
01:44120 BPMD minor
new jack swingmenacing swingsinistersynth bass
eerie synths, haunting melodies in a dark cityscape
eerie synths, haunting melodies in a dark cityscape
whispers in neon shadows
01:5395 BPMC minor
synthwavedarkwaveeeriesynthesizer
spooky synths weave a retro and suspenseful atmosphere
spooky synths weave a retro and suspenseful atmosphere
enigmatic neon skyline
01:4785 BPMA minor
synthwavedark synthmysticalsynthesizer
ominous retro synths evoke a chilling intrigue.
ominous retro synths evoke a chilling intrigue.
twilight mansion mystery
01:45115 BPMG minor
synthwavedarkwaveominoussynthesizer
suspenseful melodies in synthesizer driven eerie ambiance
suspenseful melodies in synthesizer driven eerie ambiance
haunted neon nightscapes
01:3890 BPMD# minor
electropopdarkwaveeeriesynthesizer
venture into the foggy neon lit suspense
venture into the foggy neon lit suspense
echoes through dark alleys
01:27100 BPMC minor
synthwavedarkwaveeeriesynthesizer
suspenseful disco beats with a suspenseful nocturnal twist.
suspenseful disco beats with a suspenseful nocturnal twist.
midnight mirror ball mystery
02:0075 BPMF minor
discosuspensesuspensefulsynthesizer
tense chase through neon lit cityscape.
tense chase through neon lit cityscape.
shadows creep on neon
01:4995 BPMA minor
electronicsynthwavetensesynthesizer
dark electro song with throbbing beats creating suspense
dark electro song with throbbing beats creating suspense
chasing neon shadows
01:5795 BPMD# minor
electrosynthwavesuspensefulsynthesizer
nervous synthwave pursuit through bright neon urban landscape
nervous synthwave pursuit through bright neon urban landscape
high stakes synthwave chase
01:23130 BPMD minor
synthwaveretro 80stensesynthesizer
tense beats under ethereal, resonant synth layers
tense beats under ethereal, resonant synth layers
midnight pulse revealed
02:0090 BPMC minor
future basscinematic future basstensesynthesizer
a dark dive into 80s suspenseful atmosphere.
a dark dive into 80s suspenseful atmosphere.
neon shadows unearthed
02:00100 BPMG# minor
synthwaveretromysterioussynthesizer
intense guitars echo through the dark landscape
intense guitars echo through the dark landscape
shadows creep at midnight
01:5890 BPME minor
hard rocksuspense rocktenseelectric guitar
pulsing synth driven instrumental capturing tension of retro nights
pulsing synth driven instrumental capturing tension of retro nights
midnight city's pulse
01:50145 BPMA minor
synthwavedark synthtensesynthesizer
tension builds through eerie, pulsating synth tones and shadows.
tension builds through eerie, pulsating synth tones and shadows.
neon dread awakens
01:59150 BPMF minor
synthpopdarkwavebroodingsynthesizer
chilling chase with intense and unsettling atmosphere.
chilling chase with intense and unsettling atmosphere.
relentless night pursuit
01:0690 BPMC minor
soundtrackhorror soundtracktenseviolin
eerie synths build anxious nighttime world with relentless beats.
eerie synths build anxious nighttime world with relentless beats.
electric night tension
01:56100 BPMD minor
electronicsynthwaveanxioussynthesizer
dark melodies weaving through eerie urban soundscape
dark melodies weaving through eerie urban soundscape
shadowy streets at midnight
01:2490 BPME minor
synthwavedarkwavemenacingsynthesizer
anxiety filled 80s synth track with relentless rhythmic energy
anxiety filled 80s synth track with relentless rhythmic energy
escape from neon city
01:43120 BPME minor
synthwavedarksynthtensesynthesizer
haunting 80s inspired instrumental evoking lurking danger and suspense.
haunting 80s inspired instrumental evoking lurking danger and suspense.
echoes in neon alley
01:4990 BPMD minor
synthwavedarkwavemenacingsynthesizer
dangerous beats in urban shadows.
dangerous beats in urban shadows.
dark corners groove
01:54180 BPMC minor
new jack swingmenacing swingsinistersynth bass
embrace the darkness with creeping synth melodies
embrace the darkness with creeping synth melodies
night's eerie whispers
01:51100 BPMC minor
synthwavedarkwaveunnervingsynthesizer
intense hybrid of hip hop beats and metal riffs.
intense hybrid of hip hop beats and metal riffs.
chase through dark corners
01:46160 BPMC# minor
hip hophip metaldarkelectric guitar
eerie 80s synthesizers invoke nostalgic yet fearsome atmospheres.
eerie 80s synthesizers invoke nostalgic yet fearsome atmospheres.
neon nightmares embrace
01:48120 BPMD# minor
synthwavedarkwavemysterioussynthesizer
tense 80s instrumental featuring driving rhythms and haunting melodies
tense 80s instrumental featuring driving rhythms and haunting melodies
shadow chase midnight run
01:23110 BPME minor
synthwavedarksynthtensesynthesizer
eerie synth pulses create a tense urban chase
eerie synth pulses create a tense urban chase
shadowy city pursuit
01:38130 BPMD minor
electrodark electrosuspensefulsynthesizer
thrilling 80s chase, neon lit intensity pumping excitement.
thrilling 80s chase, neon lit intensity pumping excitement.
electric midnight pursuit
01:4490 BPMC minor
synthwaveoutrunelectrifyingsynthesizer
intense 80s instrumental, electrifying synthwave pursuit.
intense 80s instrumental, electrifying synthwave pursuit.
neon thunderstorm chase
01:5690 BPMC minor
synthwaveoutrunelectrifyingsynthesizer
j pop track fuses tension and pulsating energy.
j pop track fuses tension and pulsating energy.
neon night pursuit
01:55130 BPMD minor
j popelectropoptensesynthesizer
dark, pulsating synth melodies create eerie 80s atmosphere
dark, pulsating synth melodies create eerie 80s atmosphere
urban midnight neon stalkers
01:5690 BPMD minor
synthwavedark synthwavemenacingsynthesizer
ominous synths pulsate through dark, eerie 80s landscape
ominous synths pulsate through dark, eerie 80s landscape
neon shadows haunt alley
01:2795 BPMA minor
synthwavedark synthwavemenacingsynthesizer
eerie retro synths capture neon lit, dystopian cityscape vibes
eerie retro synths capture neon lit, dystopian cityscape vibes
neon shadows loom
02:0090 BPMC minor
synthwavedark synthwaveominoussynthesizer
mysterious synth echoes in digital depths
mysterious synth echoes in digital depths
shadows creep silently
02:00120 BPMD# minor
chillwavedarkwaveominoussynthesizer
ghostly synths create an eerie, night time ambiance
ghostly synths create an eerie, night time ambiance
ghostly electric nights
01:5395 BPMD minor
synthpopdarkwaveeeriesynthesizer
dark synthwave instrumental revealing hidden secrets beneath city lights
dark synthwave instrumental revealing hidden secrets beneath city lights
neon shadows unveiled
01:52100 BPMF minor
synthwavedark synthwavesuspensefulsynthesizer
suspenseful synthwave track echoing 80s cinematic tension and intrigue
suspenseful synthwave track echoing 80s cinematic tension and intrigue
shadows in neon lights
01:37100 BPMF minor
synthwavedark synthwavesuspensefulsynthesizer
instrumental synthwave track capturing anxiety in neon lit city
instrumental synthwave track capturing anxiety in neon lit city
anxiety in neon shadows
01:2090 BPME minor
synthwavecoldwaveanxioussynthesizer
anxious, retro rhythms with haunting melodic undertones.
anxious, retro rhythms with haunting melodic undertones.
nervous neon nights
01:40110 BPMC major
synthwaveretroanxiouselectric guitar
eerie 80s synths evoke a chilling atmosphere.
eerie 80s synths evoke a chilling atmosphere.
haunting neon shadows
01:58105 BPMC minor
synthwavedarkwavemysterioussynthesizer
mysterious echoes under the haunted moonlight
mysterious echoes under the haunted moonlight
shadows creep silently
01:5580 BPMC minor
darkwavegothicmysterioussynthesizer
high speed pursuit through digital soundscapes.
high speed pursuit through digital soundscapes.
midnight neon chase
01:46120 BPMC minor
synthwaveretro futuristenergeticsynthesizer
electrifying synth chase sequence.
electrifying synth chase sequence.
under city lights
02:00120 BPMC minor
synthwaveretro futuristenergeticsynthesizer
dark tones blend with retro synths.
dark tones blend with retro synths.
midnight neon shadows
01:57100 BPME minor
synthwavedarkwavemysterioussynthesizer
sinister synths in a digital nightmare
sinister synths in a digital nightmare
shadows creep at midnight
01:43115 BPMD minor
synthwavedarkwavesinistersynthesizer
creeping mists swirl with sinister synth sounds
creeping mists swirl with sinister synth sounds
echoes in the dark mist
03:32120 BPMC# minor
synthwavehorror synthwavesinistersynthesizer
spine chilling melody with relentless uneasy tunes
spine chilling melody with relentless uneasy tunes
midnight whispers forest
02:00140 BPMF major
dubstepdarkwaveanxioussynthesizer
ethereal synths meet urban funk in a dark setting
ethereal synths meet urban funk in a dark setting
futuristic nightlife pulse
01:47110 BPMD minor
darkwavefunkybroodingbass guitar
dark and funky beats with eerie, captivating undertones
dark and funky beats with eerie, captivating undertones
dystopian funky midnight groove
01:59145 BPMC minor
darkwavefunkybroodingbass guitar
an instrumental blending eerie synths to evoke vintage mystery feelings.
an instrumental blending eerie synths to evoke vintage mystery feelings.
shadows in old alleys
01:5090 BPME minor
synthwavedarkwavemysterioussynthesizer
spooky rhythms intermingle with eerie electronic soundscapes
spooky rhythms intermingle with eerie electronic soundscapes
phantom pulse groove
01:42120 BPMD minor
electropopdarkwavecreepysynthesizer
adrenaline fueled journey through nighttime cityscape
adrenaline fueled journey through nighttime cityscape
city shadows racing pulse
02:00105 BPMD minor
synthwavegritty synthwaveenergeticsynthesizer
sinister 80s instrumental with eerie synth and dark atmosphere
sinister 80s instrumental with eerie synth and dark atmosphere
midnight neon shadows
01:2295 BPMD minor
synthwavedarkwaveominoussynthesizer
high octane drive through retro cityscape
high octane drive through retro cityscape
midnight neon chase
01:5490 BPMD minor
synthwaveretro futurismenergeticsynthesizer
dark beats merging with suspenseful, mysterious electronic layers.
dark beats merging with suspenseful, mysterious electronic layers.
midnight dance pulse
01:47165 BPME minor
dancedarkwavesuspensefulsynthesizer
dark city nights with pulsing reggaeton beats
dark city nights with pulsing reggaeton beats
night's whisper reggaeton
01:3295 BPMD minor
reggaetondark reggaetonominoussynthesizer