StockTune: Free stock music and songs
StockCake: Free AI stock photosAI Photostribal drumsbollywoodelectric guitarfreeclassicalelectronicmp3 downloader juice free musictrapenergeticjazzhip hopindianyorubaindian flutesraag bhairavidarkdarkwaveindiaepictemple
Traverse a neon drenched metropolis where electric beats and intense synths craft a tale of rebellion and hope. Vivid soundscapes bring to life towering skyscrapers, cybernetic alleyways, and a fight for freedom. An epic auditory experience capturing the chaos and beauty of a high tech, dystopian future.
Public DomainAI Generated

Neon Uprising Anthem

Electric Beats, Intense Synths In Futuristic City Dystopia

150 BPMC minor01:49

Traverse a neon drenched metropolis where electric beats and intense synths craft a tale of rebellion and hope. Vivid soundscapes bring to life towering skyscrapers, cybernetic alleyways, and a fight for freedom. An epic auditory experience capturing the chaos and beauty of a high tech, dystopian future.

synthesizerelectroniccyberpunkboldcinematicelectriccyberneticblade runnernight cityfuturistic adventuredystopian journeyneon lightshigh techpulseelectrifyingshadowed skyscrapers

Related Tags

cyberpunkcyberpunkfuturisticfuturisticneonneonelectronicelectronicnightnightdystopiandystopianurbanurbancityscapecityscapedarkdarkintenseintensetechnologytechnologycitycity100bpm100bpm

Similar Stock Music

dystopian soundscape with electrifying beats and soaring synths
dystopian soundscape with electrifying beats and soaring synths
neon horizon ascension
02:0095 BPMD minor
electroniccyberpunkboldsynthesizer
dark streets filled with cybernetic mysteries.
dark streets filled with cybernetic mysteries.
neon shadows lurk
01:57150 BPME minor
synthwavedark synthwavemenacingsynthesizer
a dark, atmospheric electro track for a dystopian future
a dark, atmospheric electro track for a dystopian future
cyberpunk nights
02:00120 BPME minor
electroniccyberpunkdarksynthesizers
high energy beats, futuristic underground tones.
high energy beats, futuristic underground tones.
neon fury unleashed
01:55140 BPME minor
cyber punkelectro industrialaggressiveelectric guitar
cyberpunk city after dark
cyberpunk city after dark
neon nights
02:00100 BPMC minor
electronicsynthwavedarksynthesizer
electrifying beats pulsate through dystopian, neon soaked cityscape adventure
electrifying beats pulsate through dystopian, neon soaked cityscape adventure
neon streets run wild
02:00140 BPMC minor
synthwavecyberpunkexcitingsynthesizer
pulsating rhythms, relentless cybernetic sound.
pulsating rhythms, relentless cybernetic sound.
dark streets symphony
01:58160 BPMA minor
cyber punkelectro industrialaggressiveelectric guitar
a dark, atmospheric cyberpunk track
a dark, atmospheric cyberpunk track
cyberpunk nights
02:00115 BPMA minor
electroniccyberpunkdarksynthesizer
pulsating beats in shadowy cyber landscapes.
pulsating beats in shadowy cyber landscapes.
neon shadows dance
04:00140 BPMF# minor
technodark technoedgysynthesizer
a dark and atmospheric cyberpunk soundtrack
a dark and atmospheric cyberpunk soundtrack
cyberpunk nights
01:58100 BPMA minor
electroniccyberpunkdarksynthesizers
exploring dark future with neon lit vibes
exploring dark future with neon lit vibes
neon shadows unfold
01:44150 BPME minor
electroniccyberpunkmysteriouselectric guitar
echoes in the neon lit night
echoes in the neon lit night
dark circuit pulse
01:40155 BPME minor
cyber punkelectronicmysterioussynthesizer
dark gritty beats under neon lights
dark gritty beats under neon lights
neon shadows fall
01:50170 BPME minor
cyber punkdarkwavebroodingsynthesizer
whispers of a digital dystopia echo
whispers of a digital dystopia echo
neon shadows glide
01:40105 BPMD minor
cyber punkelectronicmysterioussynthesizer
haunting harmonies in a high tech world
haunting harmonies in a high tech world
cityscape neon dreams
02:00100 BPME minor
cyber punkdarkwavebroodingsynthesizer
a dark, atmospheric cyberpunk instrumental
a dark, atmospheric cyberpunk instrumental
neon nights in the sprawl
01:5880 BPMA minor
electroniccyberpunkdarksynthesizer
soundtrack of a nocturnal chase.
soundtrack of a nocturnal chase.
city lights whisper
04:00145 BPMB minor
technodark technoedgysynthesizer
intense synth thriller navigating cybernetic urban underworld.
intense synth thriller navigating cybernetic urban underworld.
hacking the neon grid
01:58100 BPMG minor
cyberpunksynthwavetensesynthesizer
high octane synths propel through a neon drenched cyber metropolis
high octane synths propel through a neon drenched cyber metropolis
circuit breaker night drive
01:24125 BPMD minor
synthwavecyberpunkexcitingsynthesizer
escape into a neon infused electronic adventure.
escape into a neon infused electronic adventure.
neon dreams after dark
01:57130 BPMC minor
electroniccyber punkfuturisticsynthesizer
futuristic city nightscape, mysterious ambient sounds.
futuristic city nightscape, mysterious ambient sounds.
neon shadows unfold
02:54110 BPMG minor
ambientcyberpunkmysterioussynthesizer
driven beats, futuristic soundscapes, intense vibes, cyberpunk adventure
driven beats, futuristic soundscapes, intense vibes, cyberpunk adventure
neon city pulse
01:55100 BPME minor
electroniccyberpunkintensesynthesizer
fast paced neon journey through cyber streets.
fast paced neon journey through cyber streets.
city lights whisper
02:30100 BPMA minor
electroniccyberpunkenergeticsynthesizer
throbbing beats amid neon cityscapes, pure cyberpunk vibes
throbbing beats amid neon cityscapes, pure cyberpunk vibes
neon night drive
02:00130 BPME minor
electroniccyberpunkfuturisticsynthesizer
high energy beats driving virtual futuristic car chase
high energy beats driving virtual futuristic car chase
adrenaline pulse chase
01:58170 BPMC minor
electrocyberpunkthrillingsynthesizer
ambient echoes through a cyberpunk metropolis.
ambient echoes through a cyberpunk metropolis.
city lights whisper
04:00160 BPMD minor
ambientcyberpunkmysterioussynthesizer
high energy beats with futuristic synths and intense rhythms
high energy beats with futuristic synths and intense rhythms
neon city euphoria
01:50100 BPME minor
electroniccyberpunkexcitedsynthesizer
electrifying beats under a neon skyline
electrifying beats under a neon skyline
neon dreams unfold
01:14100 BPMC minor
electroniccyberpunkenergetictheremin
futuristic cityscape with pulsating beats.
futuristic cityscape with pulsating beats.
neon shadows unfold
04:00130 BPMD minor
electroniccyberpunkenergeticsynthesizer
serene melody amidst chaotic cyber textures
serene melody amidst chaotic cyber textures
city of cyber dreams
01:52125 BPME minor
electroniccyberpunkmysteriouselectric guitar
electrifying beats capture vibrant, futuristic nighttime adventure
electrifying beats capture vibrant, futuristic nighttime adventure
cyberpunk city run
01:57115 BPMG minor
electroniccyberpunkfuturisticsynthesizer
futuristic city sounds with electronic beats.
futuristic city sounds with electronic beats.
neon dreamscape hover
02:00140 BPME minor
electroniccyber punkenergeticsynthesizer
futuristic beats with eerie, dystopian city ambiance sounds.
futuristic beats with eerie, dystopian city ambiance sounds.
neon dreams skyline
01:57100 BPMA minor
electroniccyberpunkfuturisticsynthesizer
synths emphasize tense, futuristic city vibes.
synths emphasize tense, futuristic city vibes.
circuit city noir
01:33120 BPMD minor
cyberpunkdystopiandarksynthesizer
dark futuristic journey through pulsing neon cityscape
dark futuristic journey through pulsing neon cityscape
neon skyline chase
01:56100 BPMA minor
electroniccyberpunkfuturisticsynthesizer
journey through a neon lit urban expanse.
journey through a neon lit urban expanse.
city lights pulse
02:00140 BPMC minor
electroniccyber punkenergeticsynthesizer
a haunting voyage through digital darkness
a haunting voyage through digital darkness
dark neon conspiracy
01:55150 BPMA minor
cyber punkdarkwaveominoussynthesizer
pulsating beats for an intense city chase scene
pulsating beats for an intense city chase scene
neon future awakening
01:42125 BPMD minor
cyberpunkelectro housefieryelectric guitar
high energy beats for a cyber chase scenario
high energy beats for a cyber chase scenario
electric city pursuit
01:56125 BPMD minor
cyberpunkelectro housefieryelectric guitar
cityscape vibes under neon lit skies
cityscape vibes under neon lit skies
whispers of neon rain
02:50100 BPMD minor
synthwavecyberpunkmysterioussynthesizer
rapid electronic pulses, dark, claustrophobic, cyberpunk cityscape
rapid electronic pulses, dark, claustrophobic, cyberpunk cityscape
neon rainfall anxiety attack
01:5890 BPMC minor
cyberpunkdark synthwaveanxioussynthesizer
powerful beats with futuristic, dystopian vibes and electric melodies
powerful beats with futuristic, dystopian vibes and electric melodies
neon streets awakening
01:59150 BPMD minor
electroniccyberpunkelectrifyingsynthesizer
futuristic cityscape under neon lights
futuristic cityscape under neon lights
neon shadows pulse
01:16100 BPME major
cyberpunksynthwaveeeriesynthesizer
dark beats and pulsing synths in cyber urban landscape.
dark beats and pulsing synths in cyber urban landscape.
electric nights cyber city
00:54100 BPMC minor
electronicacyberpunkdarksynthesizer
a dark, atmospheric journey through a futuristic cityscape
a dark, atmospheric journey through a futuristic cityscape
neon nights in the sprawl
02:00120 BPMB minor
cyberpunkdark electrodarksynthesizers
heart pounding synth journey through cyber cityscape adventure
heart pounding synth journey through cyber cityscape adventure
neon night escape
02:00180 BPMD minor
electrocyberpunkthrillingsynthesizer
immerse in electronic urban nighttime journey
immerse in electronic urban nighttime journey
city lights whisper
04:00105 BPME minor
electroniccyberpunkenergeticsynthesizer
immerse in electronic urban nighttime journey
immerse in electronic urban nighttime journey
city lights whisper
04:00105 BPME minor
electroniccyberpunkenergeticsynthesizer
exploring the night in a cyber city
exploring the night in a cyber city
city lights symphony
01:48100 BPMD major
cyberpunksynthwaveeeriesynthesizer
futuristic electronic soundtrack for a neon-lit city
futuristic electronic soundtrack for a neon-lit city
cyberpunk nightride
02:00135 BPME minor
electroniccyberpunkmysterioussynthesizer
deep beats in midnight city
deep beats in midnight city
city neon echoes
01:55150 BPMG minor
cyber punkdarkwavemysterioussynthesizer
dark alleys under neon glow
dark alleys under neon glow
night lights, future frights
04:00150 BPMB minor
cyberpunkdark ambientcreepysynthesizer
uplifting beats in a futuristic cyberpunk utopia setting
uplifting beats in a futuristic cyberpunk utopia setting
neon skyline joyride
01:46130 BPMD minor
electroniccyberpunkexcitedsynthesizer
thrilling beats against a dystopian urban backdrop.
thrilling beats against a dystopian urban backdrop.
cyber uprising anthem
01:30150 BPMD minor
cyberpunkindustrialrebellioussynthesizer
experience the vibrant isolation of cyber city life
experience the vibrant isolation of cyber city life
neon urban dreamscape
04:0090 BPMC minor
synthwavecyberpunkmysterioussynthesizer
pulsating synth journey through cyborg infested neon streets.
pulsating synth journey through cyborg infested neon streets.
neon urban dystopian chase
01:23110 BPMG major
cyberpunksynthwavetensesynthesizer
cityscape pulses with electronic life.
cityscape pulses with electronic life.
neon dreams awaken
03:21150 BPMD minor
electroniccyberpunkmysterioustheremin
fast paced synths mimic nervous tension, evoke cyberpunk dystopia
fast paced synths mimic nervous tension, evoke cyberpunk dystopia
nervous system overload
01:5590 BPME minor
cyberpunkdark synthwaveanxioussynthesizer
electric beats and dark synths define urban cyberpunk.
electric beats and dark synths define urban cyberpunk.
neon streets and shadows
01:33100 BPMD minor
electronicacyberpunkdarksynthesizer
city pulses under neon rain
city pulses under neon rain
neon streets ignite
01:28125 BPME minor
electroniccyberpunkenergeticsynthesizer
a dark, atmospheric instrumental track
a dark, atmospheric instrumental track
cyberpunk nights
02:00100 BPMA minor
electroniccyberpunkdarksynthesizers
futuristic beats in a gritty urban landscape.
futuristic beats in a gritty urban landscape.
neon rebellion surge
01:28120 BPMC# minor
cyberpunkindustrialrebellioussynthesizer
blending futuristic beats with mystical neon soundscapes
blending futuristic beats with mystical neon soundscapes
mystical neon odyssey
01:1490 BPMA minor
synthwavecyberpunketherealsynthesizer
high energy rhythms soar over metropolitan sounds
high energy rhythms soar over metropolitan sounds
city lights pulse fast
01:49150 BPME minor
cyber punkdigital hardcoreenergeticsynthesizer
pulsing chase through dystopian neon lit urban jungle
pulsing chase through dystopian neon lit urban jungle
cybernetic night pursuit
01:42130 BPME minor
electroniccyberpunkfuturisticsynthesizer
the sound of tomorrow's city tonight
the sound of tomorrow's city tonight
city lights whisper
01:50110 BPME minor
electroniccyberpunkenergetictheremin
energetic synth beats meet intense cyberpunk rhythms
energetic synth beats meet intense cyberpunk rhythms
futuristic urban pulse
01:5695 BPMD minor
electroniccyberpunkexcitedsynthesizer
futuristic synths and beats drive the dynamic metropolis
futuristic synths and beats drive the dynamic metropolis
cyberpunk city's pulse
01:48120 BPMB minor
electroniccyberpunkelectrifyingsynthesizer
capturing a futuristic cityscape
capturing a futuristic cityscape
neon streets pulse
02:00100 BPMA minor
electroniccyberpunkedgyelectric guitar
electric beats in a futuristic urban landscape.
electric beats in a futuristic urban landscape.
neon city pulse
01:40120 BPMD minor
electroniccyberpunkdynamicsynthesizer
dark and atmospheric cyberpunk ambiance, perfect for brooding moments.
dark and atmospheric cyberpunk ambiance, perfect for brooding moments.
dystopian neon night
01:52100 BPME minor
cyberpunkdark synthwavesombersynthesizer
cybernetic echoes in digital fog.
cybernetic echoes in digital fog.
dark city pulse
01:50100 BPMF minor
electroniccyberpunkmysterioustheremin
edgy riffs in a dystopian sonic cityscape of dread
edgy riffs in a dystopian sonic cityscape of dread
neon streets unraveled
01:40100 BPMC minor
electroniccyberpunkanxioussynthesizer
driving rhythms, gleaming soundscapes in the cyber realm.
driving rhythms, gleaming soundscapes in the cyber realm.
city lights pulse
01:55150 BPME minor
cyber punkdigital hardcoreenergeticsynthesizer
cyberpunk cityscape
cyberpunk cityscape
night pulse in tokyo
01:58130 BPMF minor
technocyberpunkenergeticelectricbass
experience the soundscape of a neon lit dystopia.
experience the soundscape of a neon lit dystopia.
shadows of neon
02:00100 BPMC minor
electroniccyber punkmenacingsynthesizer
intriguing mix evoking dark, futuristic cities
intriguing mix evoking dark, futuristic cities
shadows cast long shadows
02:26150 BPMA minor
cyber punkelectronicsinistersynthesizer
urban energy electrified by glowing night
urban energy electrified by glowing night
city glow at midnight
01:23125 BPMB minor
electroniccyberpunkenergeticsynthesizer
high energy beats taking you on a thrilling ride
high energy beats taking you on a thrilling ride
cyber city rush
01:50120 BPMA minor
electronicsynthwaveenergeticsynthesizer
a futuristic journey through mystical neon landscapes
a futuristic journey through mystical neon landscapes
neon dream sequence
01:47105 BPMC# minor
synthwavecyberpunketherealsynthesizer
futuristic chase with relentless beats, intense electronic energy
futuristic chase with relentless beats, intense electronic energy
urban dark pulse
01:30120 BPME minor
electroniccyberpunkintensesynthesizer
dark rhythm driven beats amidst futuristic cityscape ambiance
dark rhythm driven beats amidst futuristic cityscape ambiance
neon streets unleashed
01:57150 BPME minor
electrocyberpunkdarksynthesizer
a tense chase through a futuristic city's neon lit alleys
a tense chase through a futuristic city's neon lit alleys
neon shadows pursuit
01:46130 BPMA minor
electroniccyberpunktensesynthesizer
futuristic soundscape with electronic vibes.
futuristic soundscape with electronic vibes.
city lights neon glow
01:3495 BPMA minor
electroniccyber punkfuturisticsynthesizer
cyberpunk cityscape filled with neon lights
cyberpunk cityscape filled with neon lights
neon shadows at midnight
04:00150 BPMF# minor
electroniccyberpunkfuturisticsynthesizer
feel the pulse, embrace the night
feel the pulse, embrace the night
city lights, cyber echoes
01:59170 BPME minor
electroniccyberpunkeuphoricsynthesizer
futuristic city vibes, electronic pulsating beats
futuristic city vibes, electronic pulsating beats
neon shadows dance
03:54155 BPME minor
electroniccyberpunkenergeticsynthesizer
futuristic city vibes, electronic pulsating beats
futuristic city vibes, electronic pulsating beats
neon shadows dance
03:54155 BPME minor
electroniccyberpunkenergeticsynthesizer
relentless beats in futuristic urban underworld chase soundtrack
relentless beats in futuristic urban underworld chase soundtrack
neon dystopia rivals
01:39130 BPME minor
electroniccyberpunkintensesynthesizer
dive into neon cyberpunk music journey.
dive into neon cyberpunk music journey.
city lights whisper
01:44120 BPME minor
electroniccyber punkfuturisticsynthesizer
a dark, atmospheric cyberpunk soundtrack
a dark, atmospheric cyberpunk soundtrack
neon nights in neo-tokyo
01:5885 BPMD minor
electroniccyberpunkdarksynthesizers
cyberpunk saga with hypnotic rhythms.
cyberpunk saga with hypnotic rhythms.
neon dreams collide
01:59125 BPMA minor
electroniccyber punkfuturisticsynthesizer
escaping through the city's digital shadows under night skies
escaping through the city's digital shadows under night skies
digital nightfall run
01:55100 BPMF minor
electroniccyberpunktensesynthesizer
dark electronic beats pulse relentlessly
dark electronic beats pulse relentlessly
neon shadows descend
01:45140 BPME minor
cyber punkdarkwavemenacingsynthesizer
immersive beats echo through neon soaked cyberpunk dystopia
immersive beats echo through neon soaked cyberpunk dystopia
cybernetic neon odyssey
01:45120 BPMA minor
cyberpunkfuturistic synthwavesurrealsynthesizer
glittering futuristic cityscape
glittering futuristic cityscape
neon streets aglow
01:5885 BPME minor
electroniccyberpunkmysterioussynthesizer
a pulsing, neon-lit journey through a cyberpunk cityscape
a pulsing, neon-lit journey through a cyberpunk cityscape
futuristic nights
01:58145 BPMD minor
electroniccyberpunkdarksynthesizers
ambient journey through cyberpunk cityscapes at night.
ambient journey through cyberpunk cityscapes at night.
glowing neon vapor trails
04:00125 BPME minor
electronicambient technoetherealsynthesizer
pulse pounding beats amidst neon lit urban sprawl
pulse pounding beats amidst neon lit urban sprawl
cybernetic cityscape chase
01:43150 BPME minor
electroniccyberpunktensesynthesizer