StockTune: Free stock music and songs
StockCake: Free AI stock photosAI Photossufi instrumentalmoroccanpeacefulsynthwaveparade marchsaxophoneelevator musicclassicalfuture basshard technoinstrumental k poppicnicanimeindian classical fusionaward ceremonyboom bapsitartechnoelectric guitarelectronic
Experience an instrumental synthwave adventure that blends whimsical melodies with retro futuristic sounds, taking the listener on a journey through neon lit cityscapes and nostalgic digital realms.
Public DomainAI Generated

Neon Whimsy Journey

A Whimsical Synthwave Journey Through Neon Drenched, Nostalgic Landscapes.

120 BPMC major01:55

Experience an instrumental synthwave adventure that blends whimsical melodies with retro futuristic sounds, taking the listener on a journey through neon lit cityscapes and nostalgic digital realms.

synthesizersynthwavedreamwavewhimsicalplayfulnostalgicinstrumentalsynthwavewhimsicalretroelectronicdreamyneonmelodic80s

Related Tags

instrumentalinstrumentalambientambientelectronicelectronicenergeticenergeticsynthsynthetherealetherealneonneondancedancefuturisticfuturisticurbanurbanupliftingupliftingatmosphericatmosphericdreamydreamy

Similar Stock Music

a playful synthwave melody evoking nostalgia and whimsical dreams.
a playful synthwave melody evoking nostalgia and whimsical dreams.
retro dream chronicles
01:55100 BPMF major
synthwavedreamwavewhimsicalsynthesizer
a synth driven instrumental echoing the emotions of the 80s
a synth driven instrumental echoing the emotions of the 80s
echoes in time
01:32115 BPMF major
synthwavedreamwavenostalgicsynthesizer
an emotional instrumental journey through longing and reminiscence
an emotional instrumental journey through longing and reminiscence
shadows fade away
01:5690 BPMC major
synthwavedreamwavenostalgicsynthesizer
atmospheric synth melodies evoking deep 80s nostalgia
atmospheric synth melodies evoking deep 80s nostalgia
lost in neon dreams
01:4490 BPMA minor
synthwavedreamwavenostalgicsynthesizer
synth driven melody capturing nostalgic yearning of the 80s
synth driven melody capturing nostalgic yearning of the 80s
echoes of distant memories
01:34120 BPME minor
synthwavedreamwavenostalgicsynthesizer
an instrumental synth track reflecting on 80s memories
an instrumental synth track reflecting on 80s memories
echoes in neon lights
01:44100 BPMD major
synthwavedreamwavenostalgicsynthesizer
instrumental 80s synth journey through memories and nostalgic dreams
instrumental 80s synth journey through memories and nostalgic dreams
neon dreams revisited
01:3980 BPMC major
synthwavedreamwavenostalgicsynthesizer
a yearning synthwave piece reflecting on lost moments and love
a yearning synthwave piece reflecting on lost moments and love
memories in neon lights
01:5690 BPMF major
synthwavedreamwavenostalgicsynthesizer
a nostalgic synthwave track evoking memories of a lost past
a nostalgic synthwave track evoking memories of a lost past
neon dreams fade away
01:4585 BPMC major
synthwavedreamwavenostalgicsynthesizer
a melodic synth odyssey through ethereal, nostalgic landscapes
a melodic synth odyssey through ethereal, nostalgic landscapes
starlit neon visions
01:52120 BPMC major
synthwavedreamwavenostalgicsynthesizer
an atmospheric journey through nostalgic, synth laden soundscapes
an atmospheric journey through nostalgic, synth laden soundscapes
echoes of neon dreams
01:2480 BPMC major
synthwavedreamwavenostalgicsynthesizer
vibrant electronic sounds building towards an uplifting hopeful climax
vibrant electronic sounds building towards an uplifting hopeful climax
journey towards new horizons
01:4890 BPMF major
synthwavedreamwavehopefulsynthesizer
uplifting synth harmonies guide us into a hopeful tomorrow
uplifting synth harmonies guide us into a hopeful tomorrow
embracing tomorrow's brightness
01:27100 BPMBb major
synthwavedreamwavehopefulsynthesizer
an ambient synthwave track evoking dreamy futuristic cityscapes
an ambient synthwave track evoking dreamy futuristic cityscapes
neon skyline reverie
01:52120 BPMC major
synthwavedreamwavenostalgicsynthesizer
dreamy synthwave journey through neon lit midnight city streets
dreamy synthwave journey through neon lit midnight city streets
midnight neon dreams
01:58170 BPMC minor
synthwavedreamwavenostalgicsynthesizer
a magical instrumental piece inspiring confidence through enchanting melodies
a magical instrumental piece inspiring confidence through enchanting melodies
enchanted bravery unleashed
01:55100 BPMF major
synthwavedreamwaveempoweredsynthesizer
empowering instrumental piece fusing confident rhythms with magical tones
empowering instrumental piece fusing confident rhythms with magical tones
mystic confidence unveiled
01:51120 BPMD minor
synthwavedreamwaveempoweredsynthesizer
an instrumental blending mystical ambiance with retro synth textures
an instrumental blending mystical ambiance with retro synth textures
enchanted retro melodies
01:59115 BPMF major
synthwavedreamwavedreamysynthesizer
an instrumental blending mystical melodies with retro synth grooves
an instrumental blending mystical melodies with retro synth grooves
mystic echoes rewind
02:0090 BPMC minor
synthwavedreamwavedreamysynthesizer
an instrumental fusion of ethereal sounds and retro synth vibes
an instrumental fusion of ethereal sounds and retro synth vibes
visions of neon nights
01:43115 BPMD major
synthwavedreamwavenostalgicsynthesizer
an ethereal retro instrumental journey through nostalgic synth soundscapes
an ethereal retro instrumental journey through nostalgic synth soundscapes
echoes of neon dreams
02:0095 BPMC major
synthwavedreamwavenostalgicsynthesizer
a motivating 80s synth journey that inspires with nostalgia
a motivating 80s synth journey that inspires with nostalgia
neon horizons rise
01:4490 BPME minor
synthwavedreamwavehopefulsynthesizer
an uplifting synthwave journey through nostalgic 80s soundscapes
an uplifting synthwave journey through nostalgic 80s soundscapes
echoes of neon dreams
01:40115 BPMD major
synthwavedreamwavehopefulsynthesizer
ethereal melodies meet cybernetic rhythms in a neon lit odyssey
ethereal melodies meet cybernetic rhythms in a neon lit odyssey
ascension of neon dreams
01:52100 BPMC major
synthwavedreamwaveetherealsynthesizer
an ethereal journey through a futuristic cyberpunk neon cityscape
an ethereal journey through a futuristic cyberpunk neon cityscape
echoing neon dreams
01:1390 BPMC major
synthwavedreamwaveetherealsynthesizer
emotional synthwave track evoking warm, nostalgic feelings and memories.
emotional synthwave track evoking warm, nostalgic feelings and memories.
memories in neon
01:48115 BPMC major
synthwavedreamwavenostalgicsynthesizer
heartwarming synthwave track evoking nostalgic memories and warm feelings.
heartwarming synthwave track evoking nostalgic memories and warm feelings.
neon dreams awake
01:43100 BPMG major
synthwavedreamwavenostalgicsynthesizer
a brooding instrumental merging dark synths with sparkling melodies.
a brooding instrumental merging dark synths with sparkling melodies.
echoes in glittering shadows
01:55130 BPMF# minor
synthwavedreamwavebroodingsynthesizer
dark, brooding tones meet sparkling synths in this instrumental piece.
dark, brooding tones meet sparkling synths in this instrumental piece.
glitter in the abyss
02:0095 BPMB major
synthwavedreamwavebroodingsynthesizer
an instrumental synthwave track capturing nostalgic longing for past times
an instrumental synthwave track capturing nostalgic longing for past times
neon dreams of yesterday
01:42160 BPMA minor
synthwavedreamwavemelancholicsynthesizer
a synthwave track yearning for bygone days and memories
a synthwave track yearning for bygone days and memories
echoes of lost time
01:46105 BPMC minor
synthwavedreamwavemelancholicsynthesizer
a glowing instrumental piece that illuminates hope and ambition.
a glowing instrumental piece that illuminates hope and ambition.
sparkling dreams arise
01:26120 BPMC major
synthwavedreamwaveupliftingsynthesizer
an uplifting instrumental shimmering with hope and sparkling melodies.
an uplifting instrumental shimmering with hope and sparkling melodies.
glittering hearts ascend
01:2595 BPMA minor
synthwavedreamwaveupliftingsynthesizer
a dreamy synthwave soundscape evoking nocturnal neon city wanderings
a dreamy synthwave soundscape evoking nocturnal neon city wanderings
whispers of neon dreams
01:4590 BPMEb major
synthwavedreamwavedreamysynthesizer
a dreamy synthwave instrumental journey through neon lit streets
a dreamy synthwave instrumental journey through neon lit streets
dreams under neon lights
01:2985 BPMA minor
synthwavedreamwavedreamysynthesizer
gleaming retro synthwave with dreamy soothing lush pads
gleaming retro synthwave with dreamy soothing lush pads
retro twilight dream sequence
01:3590 BPMC major
synthwavedreamwavenostalgicsynthesizer
nostalgic melody with mellow, dreamy and retro vibes
nostalgic melody with mellow, dreamy and retro vibes
golden era midnight daydream
01:55100 BPMG major
synthwavedreamwavenostalgicsynthesizer
an ambient journey exploring solitude in neon lit urban landscapes
an ambient journey exploring solitude in neon lit urban landscapes
solitude among neon streets
02:00100 BPMA major
synthwavedreamwaveintrospectivesynthesizer
an introspective synthwave journey through neon lit urban solitude
an introspective synthwave journey through neon lit urban solitude
echoes beneath neon skies
01:21120 BPMC major
synthwavedreamwaveintrospectivesynthesizer
an optimistic synthwave journey through neon lit future worlds
an optimistic synthwave journey through neon lit future worlds
dreams in neon lights
01:56130 BPMC major
synthwavedreamwavehopefulsynthesizer
an uplifting synthwave track blending hope with neon dreams
an uplifting synthwave track blending hope with neon dreams
hope in neon skies
01:43110 BPMC major
synthwavedreamwavehopefulsynthesizer
a mystical synthwave track exploring cosmic realms and neon lights
a mystical synthwave track exploring cosmic realms and neon lights
celestial synthwave voyage
02:0095 BPMF major
synthwavedreamwavedreamysynthesizer
mystical synthwave journey through cosmic neon dreams and shadows
mystical synthwave journey through cosmic neon dreams and shadows
echoes in cosmic night
01:39120 BPME minor
synthwavedreamwavedreamysynthesizer
a moving synthwave piece reflecting on deep emotions and nostalgia
a moving synthwave piece reflecting on deep emotions and nostalgia
shadows beneath neon skies
01:33105 BPMC major
synthwavedreamwavenostalgicsynthesizer
an emotional synthwave journey through lost love and memories
an emotional synthwave journey through lost love and memories
echoes of neon hearts
01:52150 BPMC major
synthwavedreamwavenostalgicsynthesizer
an uplifting track fusing retro synths with hopeful melodies.
an uplifting track fusing retro synths with hopeful melodies.
echoes of neon nights
01:3395 BPMC major
synthwavedreamwavenostalgicsynthesizer
an instrumental blending retro synths with hopeful melodies.
an instrumental blending retro synths with hopeful melodies.
dreams of neon nights
01:56115 BPMDb major
synthwavedreamwavenostalgicsynthesizer
an ambient synthwave track evoking memories under neon skies.
an ambient synthwave track evoking memories under neon skies.
whispers of neon nights
01:3690 BPMA minor
synthwavedreamwavenostalgicsynthesizer
a reflective synthwave journey through nostalgic neon lit cityscapes.
a reflective synthwave journey through nostalgic neon lit cityscapes.
reflections in neon rain
01:5890 BPMDb major
synthwavedreamwavenostalgicsynthesizer
soft synthwave soundscapes capturing tender moments under neon skies.
soft synthwave soundscapes capturing tender moments under neon skies.
midnight echoes of love
01:40100 BPMBb major
synthwavedreamwavenostalgicsynthesizer
a tender synthwave journey through nostalgic neon lit nights.
a tender synthwave journey through nostalgic neon lit nights.
whispers under neon skies
01:39100 BPMD major
synthwavedreamwavenostalgicsynthesizer
smoothly floating through luminous, serene dreamscapes of synth sounds.
smoothly floating through luminous, serene dreamscapes of synth sounds.
luminous night journey
01:52115 BPMG major
synthwavedreamwaverelaxingsynthesizer
calmly drifting through a neon lit dreamland ambiance.
calmly drifting through a neon lit dreamland ambiance.
neon tranquil escape
01:19130 BPMC major
synthwavedreamwaverelaxingsynthesizer
vibrant synthwaves evoking trippy, immersive journeys through time.
vibrant synthwaves evoking trippy, immersive journeys through time.
psychedelic neon voyage
01:5085 BPMF major
synthwavedreamwavetrippysynthesizer
retro synths creating psychedelic auditory landscapes, truly immersive.
retro synths creating psychedelic auditory landscapes, truly immersive.
neon dreamwave journey
01:2490 BPMG# minor
synthwavedreamwavetrippysynthesizer
subdued synths evoke midnight reflections in a glittering soundscape
subdued synths evoke midnight reflections in a glittering soundscape
lonely midnight reflections
01:47110 BPMD minor
synthwavedreamwavemelancholicsynthesizer
glistening melancholic themes, evoking deep night reflections
glistening melancholic themes, evoking deep night reflections
glitter tears at midnight
01:5495 BPMF major
synthwavedreamwavemelancholicsynthesizer
emotional synth waves that evoke heartfelt memories at twilight
emotional synth waves that evoke heartfelt memories at twilight
twilight synth love
01:4185 BPMC major
synthwavedreamwavenostalgicsynthesizer
warm, nostalgic synths painting twilight memories with tenderness
warm, nostalgic synths painting twilight memories with tenderness
dusk neon embrace
01:45110 BPMF major
synthwavedreamwavenostalgicsynthesizer
shimmering synths evoke nostalgic, dreamy 80s soundscapes
shimmering synths evoke nostalgic, dreamy 80s soundscapes
retro neon horizon
01:45165 BPMC minor
synthwavedreamwavedreamlikesynthesizer
retro synths float over nostalgic, ethereal soundscapes
retro synths float over nostalgic, ethereal soundscapes
neon dreamscape reverie
01:4695 BPMC major
synthwavedreamwavedreamlikesynthesizer
an atmospheric synthwave journey through nostalgic neon lit nights
an atmospheric synthwave journey through nostalgic neon lit nights
echoes of neon dreams
01:48125 BPMC major
synthwavedreamwavedreamysynthesizer
a dreamy synthwave instrumental exploring nostalgic neon lit cityscapes
a dreamy synthwave instrumental exploring nostalgic neon lit cityscapes
neon twilight overdrive
01:21115 BPMA minor
synthwavedreamwavedreamysynthesizer
a journey through dreamy synths and neon drenched city nights
a journey through dreamy synths and neon drenched city nights
starlit neon horizons
01:56100 BPMBb minor
synthwavedreamwavenostalgicsynthesizer
a dreamy synthwave journey through neon lit cityscapes at dusk
a dreamy synthwave journey through neon lit cityscapes at dusk
neon dreams at dusk
01:3285 BPMC major
synthwavedreamwavenostalgicsynthesizer
an intimate synthwave journey through warm nostalgic soundscapes.
an intimate synthwave journey through warm nostalgic soundscapes.
embracing neon dreams
01:4585 BPMF major
synthwavedreamwaveintrospectivesynthesizer
a nostalgic journey through intimate synth layers.
a nostalgic journey through intimate synth layers.
neon nights embrace
01:23165 BPMC major
synthwavedreamwaveintrospectivesynthesizer
a gentle synthwave track capturing intimate neon lit nights.
a gentle synthwave track capturing intimate neon lit nights.
neon dreams unveiled
01:49150 BPMC major
synthwavedreamwavedreamysynthesizer
an intimate synthwave journey through midnight neon lit memories.
an intimate synthwave journey through midnight neon lit memories.
whispers under neon skies
01:5480 BPMF major
synthwavedreamwavedreamysynthesizer
an ethereal journey in neon lit cybernetic digital dreamscapes.
an ethereal journey in neon lit cybernetic digital dreamscapes.
echoes of digital twilight
01:14120 BPMC major
synthwavedreamwavedreamysynthesizer
an ethereal journey through futuristic neon lit cyberpunk landscapes.
an ethereal journey through futuristic neon lit cyberpunk landscapes.
dreams in neon skies
01:5490 BPMC major
synthwavedreamwavedreamysynthesizer
a soothing synthwave piece blending nostalgia and calming synths
a soothing synthwave piece blending nostalgia and calming synths
midnight neon serenity
01:54100 BPMD minor
synthwavedreamwaveserenesynthesizer
a tranquil synthwave track evoking nostalgia and futuristic serenity
a tranquil synthwave track evoking nostalgia and futuristic serenity
beneath neon lit skies
01:18115 BPMC major
synthwavedreamwaveserenesynthesizer
synth infused 80s soundscape evoking dreamlike and nostalgic atmospheres
synth infused 80s soundscape evoking dreamlike and nostalgic atmospheres
neon skyline visions
01:5390 BPMF minor
synthwavedreamwavedreamysynthesizer
dream like 80s synth based atmospheric instrumental track
dream like 80s synth based atmospheric instrumental track
midnight neon reverie
01:20100 BPMC major
synthwavedreamwavedreamysynthesizer
an uplifting synth journey through euphoric, neon drenched landscapes.
an uplifting synth journey through euphoric, neon drenched landscapes.
euphoria under neon lights
02:0090 BPMF# major
synthwavedreamwaveeuphoricsynthesizer
an epic journey through futuristic landscapes of synthesized bliss.
an epic journey through futuristic landscapes of synthesized bliss.
neon skies ascending
01:52100 BPMG major
synthwavedreamwaveeuphoricsynthesizer
a haunting synthwave journey evoking nostalgia and lost memories
a haunting synthwave journey evoking nostalgia and lost memories
midnight's neon tears
01:54170 BPMG minor
synthwavedreamwavemelancholicsynthesizer
melancholic synthwave journey through lost memories and neon nights
melancholic synthwave journey through lost memories and neon nights
whispers of neon rain
01:2890 BPMBb major
synthwavedreamwavemelancholicsynthesizer
elevating synth melodies inspire optimism and embrace future possibilities
elevating synth melodies inspire optimism and embrace future possibilities
echoes of new dawn
01:57100 BPMC major
synthwavedreamwaveupliftingsynthesizer
an uplifting synthwave journey towards a bright and hopeful tomorrow
an uplifting synthwave journey towards a bright and hopeful tomorrow
radiant future horizon
01:5690 BPMC major
synthwavedreamwaveupliftingsynthesizer
instrumental synthwave track evoking warmth and nostalgia under neon lights
instrumental synthwave track evoking warmth and nostalgia under neon lights
embrace the neon glow
01:46100 BPMD major
synthwavedreamwavenostalgicsynthesizer
warm synthwave journey through memories and glowing city lights
warm synthwave journey through memories and glowing city lights
memories in neon glow
01:5090 BPMF major
synthwavedreamwavenostalgicsynthesizer
perfect for reflective late night journeys.
perfect for reflective late night journeys.
city lights reflections
01:4695 BPMAb major
synthwavedreamwaveetherealsynthesizer
the perfect track for nighttime driving reflection.
the perfect track for nighttime driving reflection.
neon nightscape visions
02:0090 BPMC major
synthwavedreamwaveetherealsynthesizer
lush synths paint a nostalgic journey through night skies
lush synths paint a nostalgic journey through night skies
echoes of neon dreams
01:4990 BPMF# major
synthwavedreamwavenostalgicsynthesizer
a dreamy voyage through nostalgic synth landscapes of 80s
a dreamy voyage through nostalgic synth landscapes of 80s
neon skyline memories
01:52155 BPME minor
synthwavedreamwavenostalgicsynthesizer
an ethereal electropop odyssey through luminous, otherworldly realms of sound
an ethereal electropop odyssey through luminous, otherworldly realms of sound
voyage through neon skies
01:19135 BPMA minor
electropopdreamwaveeuphoricsynthesizer
a trippy electropop voyage through neon lit cosmic dreamscapes
a trippy electropop voyage through neon lit cosmic dreamscapes
echoes of neon dreams
01:58160 BPMC major
electropopdreamwaveeuphoricsynthesizer
enigmatic synths with vivid dreamlike melodies
enigmatic synths with vivid dreamlike melodies
luminous neon melodies
02:00160 BPMA minor
synthpopdreamwavedreamysynthesizer
evocative synth melodies with dreamy atmospheric textures
evocative synth melodies with dreamy atmospheric textures
neon dreamscape journey
01:54135 BPMD minor
synthpopdreamwavedreamysynthesizer
enigmatic synth melodies creating nighttime urban wonder
enigmatic synth melodies creating nighttime urban wonder
ethereal city lights
01:5890 BPMA minor
synthpopdreamwavenostalgicsynthesizer
dreamy, retro synths evoking a nighttime cityscape journey
dreamy, retro synths evoking a nighttime cityscape journey
starlit midnight escape
01:53105 BPMF major
synthpopdreamwavenostalgicsynthesizer
dreamy synthesizer driven instrumental capturing 80s nostalgia.
dreamy synthesizer driven instrumental capturing 80s nostalgia.
starlit synthwave nostalgia
01:59105 BPMC major
synthwavedreamwavenostalgicsynthesizer
ethereal 80s instrumental with dreamy nostalgic undertones.
ethereal 80s instrumental with dreamy nostalgic undertones.
neon dreams and starlight
01:3090 BPMC major
synthwavedreamwavenostalgicsynthesizer
a nostalgic tune invoking memories and the ache of longing
a nostalgic tune invoking memories and the ache of longing
whispers of the past
01:4385 BPMA minor
synthwavedreamwavenostalgicelectric guitar
ethereal melodies evoke longing for bygone eras and lost love
ethereal melodies evoke longing for bygone eras and lost love
echoes of lost time
01:43100 BPMC major
synthwavedreamwavenostalgicelectric guitar
an ethereal synthwave odyssey through neon lit cosmic realms
an ethereal synthwave odyssey through neon lit cosmic realms
voyage through neon dreams
02:00100 BPMD major
synthwavedreamwavedreamysynthesizer
experience an ethereal synthwave voyage through luminous neon skies
experience an ethereal synthwave voyage through luminous neon skies
echoes of neon skies
02:00170 BPMC minor
synthwavedreamwavedreamysynthesizer
an immersive synth soundscape journey through neon lit cosmic vistas.
an immersive synth soundscape journey through neon lit cosmic vistas.
neon skyline night voyage
02:0095 BPMF major
synthwavedreamwavedreamysynthesizer