StockTune: Free stock music and songs
StockCake: Free AI stock photosAI Photosindiabollywoodbackground musicaward ceremonyenergeticpopularpunjabi dholcalmworldfreepianorockindian villagereflectiveambient popepic battle musicinstrumental jewishdanceheavy metalraag bhairavi
This piece combines ethereal synth patterns with gentle marimba, creating a dreamy atmosphere that feels both peaceful and whimsically magical.
Public DomainAI Generated

Whimsical Twilight Echoes

Dreamy Yet Quirky, Calm With Hints Of Magic

110 BPMD minor01:54

This piece combines ethereal synth patterns with gentle marimba, creating a dreamy atmosphere that feels both peaceful and whimsically magical.

marimbasynthwaveambient synthwavedreamywhimsicalpeacefulsynthmarimbaambientsoftdreamymagicalunusualrelaxed

Related Tags

ambientambientetherealetherealdreamydreamysereneserenesynthsynthpeacefulpeacefulsoftsoftsoothingsoothingtranquiltranquilrelaxingrelaxingreflectivereflectivemeditativemeditative

Similar Stock Music

soothing synthscape with calming marimba under an enchanted sky
soothing synthscape with calming marimba under an enchanted sky
ethereal sunset serenade
01:2990 BPMC major
synthwaveambient synthwavedreamymarimba
explore realms of serene and mystical sounds.
explore realms of serene and mystical sounds.
mystic audio voyages
01:42110 BPMD minor
ambienteclecticetherealsynthesizer
dreamy melodies with a futuristic nostalgic touch
dreamy melodies with a futuristic nostalgic touch
starry night synthscape
01:54110 BPMD minor
synthwaveambientdreamysynthesizer
gentle instrumental mixing soothing tunes with odd clockwork rhythms.
gentle instrumental mixing soothing tunes with odd clockwork rhythms.
surreal gears lullaby
01:50125 BPMC minor
ambientexperimentalrelaxedmusic box
soothing synth harmonies meld into surreal ambient soundscapes.
soothing synth harmonies meld into surreal ambient soundscapes.
otherworldly melodic timelessness
01:33120 BPMA minor
ambientetherealcurioussynthesizer
soft soothing rhythms with ambient darkwave backdrop
soft soothing rhythms with ambient darkwave backdrop
midnight velvet embrace
01:51110 BPMA minor
darkwaveambient darkwavehauntingsynthesizer
gentle synths weave through ethereal spaces
gentle synths weave through ethereal spaces
whispers in the mind
01:55100 BPMA minor
psychedelicambient psychedelicserenesynthesizer
relaxed instrumental blending music box and quirky mechanical sounds.
relaxed instrumental blending music box and quirky mechanical sounds.
whimsical clockwork daydream
01:5090 BPMC major
ambientexperimentalrelaxedmusic box
subtle melody, ambient textures, dreamy vibes
subtle melody, ambient textures, dreamy vibes
echoes in twilight glow
02:00165 BPMC minor
synthpopchillwaverelaxingsynthesizer
floating in harmonic, synthesized sound waves.
floating in harmonic, synthesized sound waves.
dreams under electric skies
01:40110 BPMF minor
chillwaveambienteuphoricsynthesizer
soft melodies float in a tranquil soundscape
soft melodies float in a tranquil soundscape
echoes of silent voices
01:58105 BPMC minor
ambientethereal wavesereneelectric piano
surreal soundscape for peaceful, dreamlike experience
surreal soundscape for peaceful, dreamlike experience
ethereal night time voyage
01:17115 BPMF major
ambientdronedreamysynthesizer
softly pulsating synth textures over dreamy swirls.
softly pulsating synth textures over dreamy swirls.
whispers in ethereal skies
01:2990 BPMF minor
ethereal waveambientetherealsynthesizer
delve into soft, melodious sounds with an eccentric touch
delve into soft, melodious sounds with an eccentric touch
echoes from silken dreams
01:41100 BPMG minor
ambientweirdsereneharp
ambient tones merging with ethereal sounds creating a surreal atmosphere.
ambient tones merging with ethereal sounds creating a surreal atmosphere.
melodies beneath glass oceans
01:55110 BPMD# minor
ambientethereal ambientdreamyhang drum
drift in celestial soundwaves, feel tranquility.
drift in celestial soundwaves, feel tranquility.
starry sky slumber
01:4590 BPMA minor
chillwaveambientcontemplativesynthesizer
peculiar synth landscapes with calm, otherworldly ambiance.
peculiar synth landscapes with calm, otherworldly ambiance.
nebula tranquility experience
01:43100 BPMA minor
ambientchillwavedreamysynthesizer
serene piano melody for deep thought.
serene piano melody for deep thought.
celestial night's whisper
02:00110 BPMC minor
ambientminimalistetherealpiano
an airy tune evoking sweet, whimsical, dreamlike cotton candy landscapes.
an airy tune evoking sweet, whimsical, dreamlike cotton candy landscapes.
floating through cotton candy
01:46110 BPMB minor
ambient popdream popwhimsicalcelesta
flowing harmony for serene twilight moments.
flowing harmony for serene twilight moments.
evening's gentle caress
01:37110 BPMB minor
ambientethereal waverelaxingharp
ambient soundscape evoking cosmic oceans and serene wonder
ambient soundscape evoking cosmic oceans and serene wonder
celestial dreamscape serenade
01:58125 BPMD minor
ethereal waveambientetherealsynthesizer
ethereal synth waves creating serene cosmic ocean vibes
ethereal synth waves creating serene cosmic ocean vibes
galactic oceanic reverie
01:53150 BPMD minor
ethereal waveambientetherealsynthesizer
gentle synths swirl in a dreamlike sequence
gentle synths swirl in a dreamlike sequence
whispers in the mist
02:00110 BPMA minor
ethereal waveambientsoothingsynthesizer
a journey through tranquil, mysterious musical landscapes.
a journey through tranquil, mysterious musical landscapes.
dreamscape ethereal sound waves
01:58105 BPMF major
ambienteclecticetherealsynthesizer
ethereal sounds entwining soft, surreal musical whispers
ethereal sounds entwining soft, surreal musical whispers
night visions unfold
01:21110 BPMG major
dream popethereal wavedreamysynthesizer
an instrumental song evoking dreamlike, magical, ethereal nighttime vibes.
an instrumental song evoking dreamlike, magical, ethereal nighttime vibes.
enchanted nighttime lullaby
01:50110 BPMG minor
ambientetherealdreamyharp
ethereal waves over soft melodic textures
ethereal waves over soft melodic textures
whispers of the void
01:28110 BPMC minor
ethereal waveambientserenesynthesizer
melody softly playing, calming one's spirit.
melody softly playing, calming one's spirit.
gentle breezes sigh
01:54110 BPMC minor
ambientetherealpeacefulflute
soothing melody that feels like a gentle dreamscape
soothing melody that feels like a gentle dreamscape
echoes from dreams
01:56110 BPMD minor
dream popambient popetherealsynthesizer
warm comforting electronica for a peaceful mindscape
warm comforting electronica for a peaceful mindscape
serene electro lullaby
01:3895 BPMA minor
electronicaambient electronicadreamysynthesizer
gentle piano stirs deep emotional waters
gentle piano stirs deep emotional waters
echoes by the brook
01:57110 BPME minor
ambientlyricalrelaxingpiano
ethereal soundscape blending reality with dreams
ethereal soundscape blending reality with dreams
whispers of the void
04:00110 BPMF# minor
dream popethereal wavedreamyviolin
gentle melody evoking calm, peaceful sensations.
gentle melody evoking calm, peaceful sensations.
whispers of the wind
01:55110 BPMA minor
ambientethereal waverelaxingflute
soft melody floating gently, soothing.
soft melody floating gently, soothing.
whispers of the wind
01:33165 BPME minor
ambientetherealpeacefulflute
serene vocals over soft, ethereal backdrop
serene vocals over soft, ethereal backdrop
whispers of the heart
02:00105 BPME minor
popdream popsereneelectric piano
relaxing, intriguing tune with a quirky edge
relaxing, intriguing tune with a quirky edge
whispers in velvet shadows
01:4975 BPMF major
ambientweirdsereneharp
ethereal soundscape with calming darkwave influences
ethereal soundscape with calming darkwave influences
velvet nightfall sanctuary
01:52170 BPMB minor
darkwaveambient darkwavehauntingsynthesizer
soft piano tinkles amid gentle disarray of ambient textures
soft piano tinkles amid gentle disarray of ambient textures
gentle chaos murmurs
01:57160 BPMA minor
ambientillbientdreamypiano
light melodies creating a calming electronic landscape
light melodies creating a calming electronic landscape
serene digital dawn
01:54110 BPMC major
electronicaambient electronicapeacefulsynthesizer
mellow tones blend with soft synth layers
mellow tones blend with soft synth layers
whispers of neon dreams
01:18100 BPMC major
synthpopchillwaverelaxingsynthesizer
surreal ambient music with cosmic, whimsical, ethereal elements.
surreal ambient music with cosmic, whimsical, ethereal elements.
interstellar whimsy soundscape
01:44110 BPMF minor
ambientpsybientetherealsynthesizer
soft melodies for calming spaces.
soft melodies for calming spaces.
floating serenity soundscape
01:47120 BPMA minor
synthpopambient synthpoprelaxingsynthesizer
floating melodies over a dreamy backdrop
floating melodies over a dreamy backdrop
ethereal whispers at midnight
01:58115 BPMC minor
electronicambientdreamysynthesizer
ethereal sounds mixed with modern synth vibes
ethereal sounds mixed with modern synth vibes
dreams beyond the clouds
01:37120 BPMC minor
synthpopethereal waveetherealsynthesizer
soothing melody flows like gentle water.
soothing melody flows like gentle water.
waves of whispered memories
01:33110 BPMC minor
ambientethereal ambientdreamyharp
gentle, ethereal synths transport listeners to blissful serenity
gentle, ethereal synths transport listeners to blissful serenity
sunlit dreams unfolding
01:52120 BPMG# minor
synthpopchillwavepeacefulsynthesizer
gentle melodies interweave through a tapestry of soft disarray
gentle melodies interweave through a tapestry of soft disarray
whispers in soft chaos
02:00155 BPMA minor
ambientillbientdreamypiano
delicate synths paint a soothing electronic backdrop
delicate synths paint a soothing electronic backdrop
whispering synth waves
01:55120 BPME minor
electronicaambient electronicapeacefulsynthesizer
imagine a peaceful electronic journey through reflective dreams
imagine a peaceful electronic journey through reflective dreams
ethereal electric serene dream
01:52180 BPMA minor
edmambient housecontemplativesynthesizer
transport to serene, otherworldly dimensions.
transport to serene, otherworldly dimensions.
whispers from the cosmos
01:58120 BPMF minor
electronicambientdreamysynthesizer
feel the rhythm in darkness.
feel the rhythm in darkness.
whispers in the dark
01:3490 BPMA minor
ambientdark ambientenergeticsynthesizer
intriguing mix of beats and whispers.
intriguing mix of beats and whispers.
shadows dance silently
01:3490 BPMA minor
ambientdark ambientenergeticsynthesizer
tranquil cosmic soundscape with ethereal flowing melodies and rhythms.
tranquil cosmic soundscape with ethereal flowing melodies and rhythms.
cosmic dreamscape soundwaves
01:36110 BPMC minor
easy listeningtrippydreamysynthesizer
whimsical and dreamy ethereal melodies with playful undertones
whimsical and dreamy ethereal melodies with playful undertones
celestial toy music wonderland
01:55105 BPMG minor
etherealnoveltywhimsicaltoy piano
a soothing instrumental journey through surreal and ethereal soundscapes.
a soothing instrumental journey through surreal and ethereal soundscapes.
echoes in glass caverns
01:46105 BPMA minor
ambientethereal ambientdreamyhang drum
an uplifting melody blending harp with electronic textures.
an uplifting melody blending harp with electronic textures.
whispering winds of hope
01:56110 BPMC major
ambientceltic fusionheartwarmingceltic harp
gentle minimal piano inspiring serenity and introspection
gentle minimal piano inspiring serenity and introspection
echoes in silence
01:48110 BPMF minor
ambientminimalismcalmpiano
soothing synth patterns encounter psychedelic soundscapes
soothing synth patterns encounter psychedelic soundscapes
dreams of electric sheep
01:50120 BPMBb major
psychedelicambient psychedelicserenesynthesizer
ethereal melody captured in a breezy tune
ethereal melody captured in a breezy tune
whispers of the wind
01:5290 BPMF minor
ambientethereal winddreamyflute
gentle synth waves embracing tranquility
gentle synth waves embracing tranquility
whispering wind calls
01:33110 BPMD minor
ambientethereal waverelaxingsynthesizer
gentle synths creating peaceful evening electronic harmonies
gentle synths creating peaceful evening electronic harmonies
calm electronic evening
01:5190 BPMG minor
electronicaambient electronicarelaxingsynthesizer
a serene melody with gentle synth and dreamy beats.
a serene melody with gentle synth and dreamy beats.
whispered midnight dreams
01:38110 BPMC major
bedroom popsophisticated bedroom popdreamysynthesizer
gentle tones envelop in calming waves.
gentle tones envelop in calming waves.
whispers in the mist
01:46110 BPMF# minor
ambientethereal waverelaxingsynthesizer
soft, mystical tones evoke dreamlike states
soft, mystical tones evoke dreamlike states
whispers of ethereal dreams
01:58165 BPMA minor
ambientethereal wavemysteriousharp
ethereal sounds float through dreamy landscapes.
ethereal sounds float through dreamy landscapes.
whispers of the night
01:27110 BPMD major
ambientdream popetherealsynthesizer
a soothing synthpop instrumental with gentle rhythms and airy textures
a soothing synthpop instrumental with gentle rhythms and airy textures
floating in digital seas
01:5090 BPMF minor
synthpopambient popserenesynthesizer
serene tones mingle with delicate synth harmonies
serene tones mingle with delicate synth harmonies
waves of quietude
01:46110 BPMG major
ambientchillwavepeacefulsynthesizer
floating through ethereal landscapes, surreal and soothing ambiance
floating through ethereal landscapes, surreal and soothing ambiance
celestial dreamscape journey
01:37125 BPMAb major
ambientdronedreamysynthesizer
flowing whispers in an ethereal night
flowing whispers in an ethereal night
dreamscape harmonies
01:22120 BPMC major
dream popethereal wavedreamysynthesizer
peaceful melodies with warm, soothing techno sounds
peaceful melodies with warm, soothing techno sounds
neon nighttime wanderlust
01:27105 BPMA minor
technoambient technotendersynthesizer
soothing synth layers meet gentle beats.
soothing synth layers meet gentle beats.
dream clouds drift away
01:45105 BPME minor
synthpopambient synthpoprelaxingsynthesizer
ethereal waves with smooth melodic transitions throughout.
ethereal waves with smooth melodic transitions throughout.
azure dreamscapes harmony
01:53115 BPMD minor
waveethereal wavetranquilsynthesizer
soothing, ambient ethereal wave score
soothing, ambient ethereal wave score
mystic dreams whispered
01:56100 BPMD minor
ethereal waveambientserenesynthesizer
seamless ambient melody, cosmic engagement.
seamless ambient melody, cosmic engagement.
echoes of the void
01:58115 BPMA minor
ambientethereal waveetherealsynthesizer
soft, ethereal melodies blending minimal piano and ambient textures
soft, ethereal melodies blending minimal piano and ambient textures
whispering celestial melodies
01:20115 BPMG major
ambientminimalistdreamypiano
ethereal melodies weaving through otherworldly atmospheric textures.
ethereal melodies weaving through otherworldly atmospheric textures.
celestial whispering dreamscape
01:50115 BPMEb major
ambientetherealcurioussynthesizer
ethereal soundscape for calm minds.
ethereal soundscape for calm minds.
breeze of serenity
01:5190 BPMF major
ambientetherealpeacefulflute
ethereal beats meet haunting electronic symphony
ethereal beats meet haunting electronic symphony
whispers of digital dreams
01:59105 BPMA minor
electronicaethereal electronicaetherealsynthesizer
a tranquil and mesmerizing ambient soundscape
a tranquil and mesmerizing ambient soundscape
ethereal dreamscape
01:54100 BPMD minor
ambientdowntempocalmsynthesizer
ethereal tones blend with distant echoes
ethereal tones blend with distant echoes
whispers through the fog
01:2490 BPMC# minor
indiedream popetherealsynthesizer
ambient waves flow through cosmic dreamy celestial soundscape.
ambient waves flow through cosmic dreamy celestial soundscape.
echoes of celestial winds
01:41100 BPME minor
ethereal waveambientmysticalsynthesizer
a soft, dreamy instrumental track that transports the listener to a peaceful state of mind
a soft, dreamy instrumental track that transports the listener to a peaceful state of mind
floating on a cloud
01:58110 BPMA major
ambientchillwavepeacefulpiano
soft rhythms with tender harmonies, soothing and energizing
soft rhythms with tender harmonies, soothing and energizing
liquid harmony drift
01:51115 BPMC minor
drum and bassliquid funkblissfuldrum kit
soft melody floats over dreamy landscapes
soft melody floats over dreamy landscapes
whispers of a dreamland
01:4485 BPMG minor
ambientethereal wavepeacefulmusic box
gentle cascades of soothing tones envelop you.
gentle cascades of soothing tones envelop you.
echoes in darkness
01:57110 BPMC major
ambientdream popetherealsynthesizer
delicate soundscape with serene synth melodies
delicate soundscape with serene synth melodies
echoes in the twilight
02:00105 BPME minor
synthpopambient synthpopserenesynthesizer
melodic whispers over soothing synthesizer undertones
melodic whispers over soothing synthesizer undertones
echoes through eternity
03:03100 BPMA minor
ambient popethereal waveserenevocals
ethereal voices meet minimalist synth vibes
ethereal voices meet minimalist synth vibes
whispers of silent space
02:12100 BPMA minor
ambient popethereal waveserenevocals
cosmic echoes in a soft, ethereal minimalist piece.
cosmic echoes in a soft, ethereal minimalist piece.
echoes of tranquil cosmos
01:57125 BPMF minor
etherealminimaletherealsynthesizer
vibrant ambience wrapped in ethereal dreaminess
vibrant ambience wrapped in ethereal dreaminess
neon dreamscape
01:56120 BPMC minor
dream popvibrant etherealeuphoricsynthesizer
soft echoes through cosmic mist
soft echoes through cosmic mist
stars in velvet darkness
01:40125 BPMC minor
dream popenigmaticetherealsynthesizer
calm and soothing techno with ethereal synth melodies
calm and soothing techno with ethereal synth melodies
dreamwave electric serenity
01:38130 BPMC minor
technoambient technopeacefulsynthesizer
dreamlike melodies meet nostalgic vibes
dreamlike melodies meet nostalgic vibes
clouds over silent town
01:58110 BPMC minor
ambientethnic fusiondreamyacoustic guitar
sweeping synths, aerial ambience, tranquil vibes
sweeping synths, aerial ambience, tranquil vibes
skyward ethereal echoes
01:51105 BPMD minor
ethereal waveambientetherealsynthesizer
synthetic sounds blend creating futuristic calm atmosphere
synthetic sounds blend creating futuristic calm atmosphere
neon skyline reverie
01:42105 BPMF minor
ambientfuturistic ambientetherealsynthesizer
soft, hypnotic layers create a mesmerizing, dreamlike escape
soft, hypnotic layers create a mesmerizing, dreamlike escape
serene electronic slumber
02:00105 BPMC major
electronicambient popetherealsynthesizer
a heartwarming, unusual blend of nostalgic and futuristic sounds
a heartwarming, unusual blend of nostalgic and futuristic sounds
kaleidoscope of warm memories
01:59115 BPMD major
ambient popchillwavenostalgicsynthesizer
lighthearted melodies float on a clear day
lighthearted melodies float on a clear day
skyward soaring dreams
04:00110 BPMD major
ambientchilloutdreamyflute
soothing tones blend with serene soundscapes.
soothing tones blend with serene soundscapes.
whispers of distant waves
04:00125 BPMF# minor
chilloutambientrelaxingelectric piano
soft soundscape, serene flow, harmonious vibes.
soft soundscape, serene flow, harmonious vibes.
dream’s whispering winds
02:00115 BPMA minor
ambienteclecticetherealsynthesizer