StockTune: Free stock music and songs
StockCake: Free AI stock photosAI PhotosYouTubetrapgentletechnotranquilmysticalguitarnightdreamysynthwavepeacefuldynamicworld fusionmelancholicenergeticdarkhopefulambientrockfunepic
An instrumental dance pop piece featuring dreamy synth melodies over vibrant beats, crafting an enchanting soundscape that invites listeners into a world of electric dreams.
Public DomainAI Generated

Whispers Of Electric Dreams

Dreamlike Dance Track With Enchanting Synths And Vibrant Beats

120 BPMC major01:38

An instrumental dance pop piece featuring dreamy synth melodies over vibrant beats, crafting an enchanting soundscape that invites listeners into a world of electric dreams.

synthesizerdance popdream popdreamyeuphoricenchantinginstrumentaldance popdreamlikesynthesizeretherealrhythmicenergeticmelodicatmosphericvibrant

Related Tags

dancedanceenergeticenergeticetherealetherealambientambientsynthsynthvibrantvibrantelectronicelectronicdreamydreamyupliftingupliftingupbeatupbeat130 bpm130 bpm

Similar Stock Music

gentle beats, floating melodies, soothing night
gentle beats, floating melodies, soothing night
moonlit synth whispers
01:49130 BPMC major
dance popdream popetherealsynthesizer
soft synths, ethereal vocals, dreamy loops
soft synths, ethereal vocals, dreamy loops
whispers under moonlight
01:34110 BPMA minor
dance popdream popetherealsynthesizer
let the music transport you to a starry night
let the music transport you to a starry night
stars in your eyes
02:00100 BPMC major
dance popdream popdreamysynthesizer
ethereal beats merge with dreamy synths
ethereal beats merge with dreamy synths
dance under starlight
01:39130 BPMF major
dance popdream popdreamysynthesizer
uplifting dance pop immersed in celestial, dreamy nightscapes
uplifting dance pop immersed in celestial, dreamy nightscapes
celestial dream pop beats
02:00130 BPMF# minor
dance popdream popetherealsynthesizer
hypnotic dance pop with ethereal synth melodies weaving magic!
hypnotic dance pop with ethereal synth melodies weaving magic!
starlit dreamscape dance beats
01:56135 BPMF major
dance popdream popetherealsynthesizer
light beats with soaring ethereal sounds
light beats with soaring ethereal sounds
heavenly dream float
01:59120 BPME major
dream popecstatic dream popserenesynthesizer
gentle beats under ethereal floating melodies
gentle beats under ethereal floating melodies
cloud feathers touching dreams
01:40140 BPMD major
dream popecstatic dream popserenesynthesizer
ethereal dance pop song with enchanting synth leads.
ethereal dance pop song with enchanting synth leads.
galactic starlit groove
01:57130 BPMF major
dance popdream popdreamysynthesizer
dreamlike dance pop song with captivating dreamy synth melodies.
dreamlike dance pop song with captivating dreamy synth melodies.
starlit dreamy dancefloor
01:12135 BPMD major
dance popdream popdreamysynthesizer
bright, melodic dream pop capturing essence of sunset tranquility
bright, melodic dream pop capturing essence of sunset tranquility
golden sunset reverie
01:3595 BPMEb major
dream popelectronic dream pophappysynthesizer
happy, uplifting dream pop with shimmering melodic elements
happy, uplifting dream pop with shimmering melodic elements
summer sunshine dreamland
01:59155 BPMC major
dream popelectronic dream pophappysynthesizer
gentle rhythms with lush, enchanting synth melodies
gentle rhythms with lush, enchanting synth melodies
serene moonlight reverie
01:5590 BPMBb major
k popdream popdreamysynthesizer
effervescent melodies blend with dreamy synth textures
effervescent melodies blend with dreamy synth textures
moonlit fantasy dreamscape
01:44100 BPMF major
k popdream popdreamysynthesizer
gentle j pop fusion creating a nostalgic, dreamlike soundscape
gentle j pop fusion creating a nostalgic, dreamlike soundscape
whimsical starry serenade
01:5585 BPMA major
j popdream popdreamysynthesizer
soothing j pop melody with a dreamy, ethereal feel
soothing j pop melody with a dreamy, ethereal feel
pastel cloud dreams
01:5790 BPMC major
j popdream popdreamysynthesizer
ethereal dancepop with euphoric rhythms, capturing night sky enchantment.
ethereal dancepop with euphoric rhythms, capturing night sky enchantment.
night sky dream sequence
01:57105 BPMG major
dancepopdream popdreamysynthesizer
uplifting dancepop with ethereal dreamy elements, perfect for starlit nights.
uplifting dancepop with ethereal dreamy elements, perfect for starlit nights.
starlight dreams dancefloor vibes
01:15160 BPMEb major
dancepopdream popdreamysynthesizer
dance under shimmering ethereal lights
dance under shimmering ethereal lights
under starlit grooves
01:58110 BPMA minor
discodream popetherealsynthesizer
ethereal k pop adventure with shimmering electronic dreamscapes
ethereal k pop adventure with shimmering electronic dreamscapes
celestial dreamscape melody
01:32140 BPMC major
k popdream popdreamysynthesizer
dreamy k pop journey with sparkling electronic undertones
dreamy k pop journey with sparkling electronic undertones
neon stardust reverie
02:00155 BPMC minor
k popdream popdreamysynthesizer
a soft, uplifting track to start your day
a soft, uplifting track to start your day
morning's gentle embrace
01:4375 BPMC major
dream popambient pophopefulsynthesizer
hopeful melody swirls like morning mist
hopeful melody swirls like morning mist
clouds of lavender light
02:0090 BPMD major
dream popambient pophopefulsynthesizer
serene sea under ethereal moonlight
serene sea under ethereal moonlight
moonlit echoes calm
01:5990 BPMA major
dream popambient popserenesynthesizer
ethereal echoes under a moonlit sky
ethereal echoes under a moonlit sky
whispers of lunar seas
01:25130 BPMC minor
dream popambient popserenesynthesizer
synth beats, starry ambiance, ethereal dreamscape dancepop orchestration
synth beats, starry ambiance, ethereal dreamscape dancepop orchestration
galactic dance under stars
01:52100 BPMG major
dancepopdream popdreamysynthesizer
irresistible beat, shimmering synths, dreamlike starry atmosphere perfection
irresistible beat, shimmering synths, dreamlike starry atmosphere perfection
starlit dreamscape dancefloor glow
01:5085 BPMF major
dancepopdream popdreamysynthesizer
dreamy soundscape for night time escapade.
dreamy soundscape for night time escapade.
cosmic dance dreams
01:38130 BPMC minor
dancepopdream popdreamysynthesizer
ethereal beats under cosmic starlit skies.
ethereal beats under cosmic starlit skies.
starry night serenade
01:47125 BPMC major
dancepopdream popdreamysynthesizer
dreamy, soft melody for romantic and reflective moments
dreamy, soft melody for romantic and reflective moments
moonlit bedroom whisper
01:55105 BPMD major
bedroom popdream popsensualsynthesizer
ethereal melody for intimate, relaxed, and dreamlike moments. soft and soothing
ethereal melody for intimate, relaxed, and dreamlike moments. soft and soothing
candlelit velvet dreams
01:5080 BPMDb major
bedroom popdream popsensualsynthesizer
festive soundscape with ethereal, wintry dream pop vibes
festive soundscape with ethereal, wintry dream pop vibes
holiday dreamscape
01:40120 BPMC major
dream popfestive dream popmysticalsynthesizer
dreamlike festive ambiance with ethereal holiday lights soundscape
dreamlike festive ambiance with ethereal holiday lights soundscape
ethereal holiday lights
01:33100 BPMC major
dream popfestive dream popmysticalsynthesizer
echoing synth melodies, uplifting beats, and celestial soundscape
echoing synth melodies, uplifting beats, and celestial soundscape
celestial skyward journey
01:34150 BPME major
dream popdream pophopefulsynthesizer
empowering dream pop melody with echoing synths and uplifting beats
empowering dream pop melody with echoing synths and uplifting beats
skyward soaring dreams
02:0085 BPMB major
dream popdream pophopefulsynthesizer
lush soundscapes evoke gentle cascading synth waves
lush soundscapes evoke gentle cascading synth waves
sunlit meadow daydream
01:51140 BPMC major
dream popambient dream popdreamysynthesizer
dreamy, lush soundscapes with gentle cascading synth waves
dreamy, lush soundscapes with gentle cascading synth waves
ethereal echoes of summer
01:13115 BPMG major
dream popambient dream popdreamysynthesizer
embrace the urban night with lush sounds.
embrace the urban night with lush sounds.
city lights serenade
01:57120 BPMC major
dream popvibrant dream popeuphoricsynthesizer
lush soundscape meets vibrant city lights.
lush soundscape meets vibrant city lights.
gleaming echoes of neon
01:37130 BPMC major
dream popvibrant dream popeuphoricsynthesizer
smooth dance pop track with reflective emotional layers
smooth dance pop track with reflective emotional layers
dreamy dance upon night
02:00110 BPMC major
dance popdream popetherealsynthesizer
ethereal beat with floating synthesizer melody
ethereal beat with floating synthesizer melody
skies reflect your dreams
01:3495 BPMC major
dance popdream popetherealsynthesizer
ethereal dreamscape with wistful soundscapes and serene melancholy.
ethereal dreamscape with wistful soundscapes and serene melancholy.
starlit sky melancholy
01:3390 BPMC major
dream popsomber dream popmelancholicsynthesizer
ethereal dreamscape evoking wistful somberness and serene melancholy.
ethereal dreamscape evoking wistful somberness and serene melancholy.
moonlit echoes reverie
01:4485 BPMG major
dream popsomber dream popmelancholicsynthesizer
serene reflective pop with ethereal elements and wistful melodies
serene reflective pop with ethereal elements and wistful melodies
mirror of past times
01:57115 BPMF major
popdream popnostalgicsynthesizer
gentle introspective pop with nostalgic undertones and dreamy textures
gentle introspective pop with nostalgic undertones and dreamy textures
reflections of forgotten days
01:4495 BPMG major
popdream popnostalgicsynthesizer
whimsical k pop with starlit, ethereal melodies and gentle instruments
whimsical k pop with starlit, ethereal melodies and gentle instruments
celestial night fantasy
01:4090 BPME major
k popdream popdreamysynthesizer
dreamy k pop with celestial, ethereal soundscapes and whimsical flourishes
dreamy k pop with celestial, ethereal soundscapes and whimsical flourishes
starlit melodies fantasy dream
01:3690 BPMC major
k popdream popdreamysynthesizer
dreamy k pop instrumental evoking celestial serenity and wonder
dreamy k pop instrumental evoking celestial serenity and wonder
starry night reverie
01:45155 BPMC minor
k popdream popetherealsynthesizer
a dreamy k pop instrumental with celestial synthesis allure
a dreamy k pop instrumental with celestial synthesis allure
celestial dreamscapes symphony
01:58100 BPMC major
k popdream popetherealsynthesizer
elevating melodies with a confident touch.
elevating melodies with a confident touch.
ascending above the clouds
01:5585 BPMC major
dream popambient popetherealsynthesizer