StockTune: Free stock music and songs
StockCake: Free AI stock photosAI PhotosYouTubeclassicalmysticalhopefulatmosphericafrobeatelectronicsynthwavenightsoftcorporatefunnycinematicromanticemotionaldarkmotivational musicetherealoktoberfest130 bpmvibrant
A soothing instrumental synthwave track that evokes the nostalgic feelings of cruising under neon lit skies. Soft synth melodies blend with gentle beats to create a dreamy atmosphere reminiscent of 1980s retro futurism.
Public DomainAI Generated

Whispers Of Neon Skies

Gentle Synthwave Journey Through Nostalgic And Dreamy Soundscapes.

90 BPMA minor01:10

A soothing instrumental synthwave track that evokes the nostalgic feelings of cruising under neon lit skies. Soft synth melodies blend with gentle beats to create a dreamy atmosphere reminiscent of 1980s retro futurism.

synthesizersynthwavedreamwavedreamynostalgicsoothingambientinstrumentalretro futurismmellowneon1980srelaxing

Related Tags

etherealetherealambientambientsynthsynthdreamydreamyelectronicelectronicenergeticenergeticneonneondancedancefuturisticfuturisticurbanurbansereneserene130 bpm130 bpm

Similar Stock Music

gleaming retro synthwave with dreamy soothing lush pads
gleaming retro synthwave with dreamy soothing lush pads
retro twilight dream sequence
01:3590 BPMC major
synthwavedreamwavenostalgicsynthesizer
nostalgic melody with mellow, dreamy and retro vibes
nostalgic melody with mellow, dreamy and retro vibes
golden era midnight daydream
01:55100 BPMG major
synthwavedreamwavenostalgicsynthesizer
synth infused 80s soundscape evoking dreamlike and nostalgic atmospheres
synth infused 80s soundscape evoking dreamlike and nostalgic atmospheres
neon skyline visions
01:5390 BPMF minor
synthwavedreamwavedreamysynthesizer
dream like 80s synth based atmospheric instrumental track
dream like 80s synth based atmospheric instrumental track
midnight neon reverie
01:20100 BPMC major
synthwavedreamwavedreamysynthesizer
enigmatic synths with vivid dreamlike melodies
enigmatic synths with vivid dreamlike melodies
luminous neon melodies
02:00160 BPMA minor
synthpopdreamwavedreamysynthesizer
evocative synth melodies with dreamy atmospheric textures
evocative synth melodies with dreamy atmospheric textures
neon dreamscape journey
01:54135 BPMD minor
synthpopdreamwavedreamysynthesizer
dreamy synthesizer driven instrumental capturing 80s nostalgia.
dreamy synthesizer driven instrumental capturing 80s nostalgia.
starlit synthwave nostalgia
01:59105 BPMC major
synthwavedreamwavenostalgicsynthesizer
ethereal 80s instrumental with dreamy nostalgic undertones.
ethereal 80s instrumental with dreamy nostalgic undertones.
neon dreams and starlight
01:3090 BPMC major
synthwavedreamwavenostalgicsynthesizer
lush 1980s synth driven nostalgic instrumental fantasy.
lush 1980s synth driven nostalgic instrumental fantasy.
echoes of neon nights
01:51160 BPMF major
synthwavedreamwavenostalgicsynthesizer
dreamy 1980s synth driven nostalgic instrumental composition.
dreamy 1980s synth driven nostalgic instrumental composition.
retro dreamscape echoes
01:4290 BPMC minor
synthwavedreamwavenostalgicsynthesizer
energetic synth beats light up nostalgic urban landscapes.
energetic synth beats light up nostalgic urban landscapes.
retro electro sunshine
01:22120 BPMC major
synthwavedreamwavejoyfulsynthesizer
shimmering synth melodies echo through nostalgic neon lights.
shimmering synth melodies echo through nostalgic neon lights.
electric neon dreamscape
01:2885 BPME minor
synthwavedreamwavejoyfulsynthesizer
heartfelt nostalgia using 80s synths creating a somber atmosphere
heartfelt nostalgia using 80s synths creating a somber atmosphere
echoes of lost time
01:25100 BPMC# minor
synthwavedreamwavemelancholicsynthesizer
melancholic instrumental with 80s synth driven soundscape and nostalgia
melancholic instrumental with 80s synth driven soundscape and nostalgia
neon dreams gone forever
01:52115 BPMA minor
synthwavedreamwavemelancholicsynthesizer
nostalgic synths create a dreamy retro soundscape journey.
nostalgic synths create a dreamy retro soundscape journey.
vintage dreamscape journey
01:19100 BPMC major
synthwavedreamwavenostalgicsynthesizer
sensual and dreamy 80s inspired instrumental with lush synths
sensual and dreamy 80s inspired instrumental with lush synths
electric dreams desire pulse
01:3980 BPMA minor
synthwavedreamwavesensualsynthesizer
synth heavy, sensual instrumental reminiscent of 80s romance drama
synth heavy, sensual instrumental reminiscent of 80s romance drama
neon nights seduction groove
01:41150 BPMF major
synthwavedreamwavesensualsynthesizer
vibrant synthwaves evoking trippy, immersive journeys through time.
vibrant synthwaves evoking trippy, immersive journeys through time.
psychedelic neon voyage
01:5085 BPMF major
synthwavedreamwavetrippysynthesizer
retro synths creating psychedelic auditory landscapes, truly immersive.
retro synths creating psychedelic auditory landscapes, truly immersive.
neon dreamwave journey
01:2490 BPMG# minor
synthwavedreamwavetrippysynthesizer
subdued synths evoke midnight reflections in a glittering soundscape
subdued synths evoke midnight reflections in a glittering soundscape
lonely midnight reflections
01:47110 BPMD minor
synthwavedreamwavemelancholicsynthesizer
glistening melancholic themes, evoking deep night reflections
glistening melancholic themes, evoking deep night reflections
glitter tears at midnight
01:5495 BPMF major
synthwavedreamwavemelancholicsynthesizer
emotional synth waves that evoke heartfelt memories at twilight
emotional synth waves that evoke heartfelt memories at twilight
twilight synth love
01:4185 BPMC major
synthwavedreamwavenostalgicsynthesizer
warm, nostalgic synths painting twilight memories with tenderness
warm, nostalgic synths painting twilight memories with tenderness
dusk neon embrace
01:45110 BPMF major
synthwavedreamwavenostalgicsynthesizer
shimmering synths evoke nostalgic, dreamy 80s soundscapes
shimmering synths evoke nostalgic, dreamy 80s soundscapes
retro neon horizon
01:45165 BPMC minor
synthwavedreamwavedreamlikesynthesizer
retro synths float over nostalgic, ethereal soundscapes
retro synths float over nostalgic, ethereal soundscapes
neon dreamscape reverie
01:4695 BPMC major
synthwavedreamwavedreamlikesynthesizer
dreamy 80s synthscape exploring a cosmic neon lit night.
dreamy 80s synthscape exploring a cosmic neon lit night.
cosmic night lights
01:38125 BPMD minor
synthwavedreamwavedreamysynthesizer
ethereal 80s synth journey through neon soaked night sky.
ethereal 80s synth journey through neon soaked night sky.
neon noir dreamscape
01:51100 BPMA minor
synthwavedreamwavedreamysynthesizer
soothing, rich synths under starlit skies.
soothing, rich synths under starlit skies.
starry night voyage
01:56110 BPME minor
synthwavedreamwaveetherealsynthesizer
a haunting, ethereal journey through sound.
a haunting, ethereal journey through sound.
midnight drift echoes
01:56100 BPMDb major
synthwavedreamwaveetherealsynthesizer
perfect for reflective late night journeys.
perfect for reflective late night journeys.
city lights reflections
01:4695 BPMAb major
synthwavedreamwaveetherealsynthesizer
the perfect track for nighttime driving reflection.
the perfect track for nighttime driving reflection.
neon nightscape visions
02:0090 BPMC major
synthwavedreamwaveetherealsynthesizer
synths craft dreamy hypnotic cityscape of deep night
synths craft dreamy hypnotic cityscape of deep night
electric urban dreams
01:34120 BPMA minor
synthwavedreamwavenostalgicsynthesizer
dreamy synths paint cityscape's hypnotic midnight hues
dreamy synths paint cityscape's hypnotic midnight hues
neon noir nightscape
01:55115 BPMC major
synthwavedreamwavenostalgicsynthesizer
synth waves echo unrequited love in a neon skyline.
synth waves echo unrequited love in a neon skyline.
retro city nights
01:50100 BPMF major
synthpopdreamwavelongingsynthesizer
dreamy synths reflecting on a distant heartache.
dreamy synths reflecting on a distant heartache.
neon city nostalgia
01:32140 BPMF major
synthpopdreamwavelongingsynthesizer
melancholic synth layers invite reflective, contemplative exploration.
melancholic synth layers invite reflective, contemplative exploration.
wistful synth reveries
01:5990 BPMEb major
synthpopdreamwavenostalgicsynthesizer
synth melodies evoke introspective, nostalgic, dreamy reflections.
synth melodies evoke introspective, nostalgic, dreamy reflections.
nostalgic neon dreamscapes
01:5590 BPMG major
synthpopdreamwavenostalgicsynthesizer
a dreamy, atmospheric synthwave track perfect for late night drives
a dreamy, atmospheric synthwave track perfect for late night drives
neon nights
01:58120 BPMG minor
synthwavedreamwavedreamysynthesizers
nostalgic melodies with calming, dream like retro synth sounds.
nostalgic melodies with calming, dream like retro synth sounds.
nostalgic synthwave journey
01:5490 BPMC major
synthwavedreamwavedreamysynthesizer
dreamy retro vibes with ethereal synth melodies intertwine beautifully.
dreamy retro vibes with ethereal synth melodies intertwine beautifully.
retro dreamscape reverie
01:58105 BPMG major
synthwavedreamwavedreamysynthesizer
ethereal synths and hypnotic beats driving fantasy world
ethereal synths and hypnotic beats driving fantasy world
cosmic anime nebula voyage
01:5890 BPMD major
electronicsynthwavedreamysynthesizer
hypnotic, ethereal sounds evoke dreamy anime fantasy scenes
hypnotic, ethereal sounds evoke dreamy anime fantasy scenes
celestial dreamwave anime odyssey
01:50100 BPMC major
electronicsynthwavedreamysynthesizer
enigmatic synth melodies creating nighttime urban wonder
enigmatic synth melodies creating nighttime urban wonder
ethereal city lights
01:5890 BPMA minor
synthpopdreamwavenostalgicsynthesizer
dreamy, retro synths evoking a nighttime cityscape journey
dreamy, retro synths evoking a nighttime cityscape journey
starlit midnight escape
01:53105 BPMF major
synthpopdreamwavenostalgicsynthesizer
embark on ethereal journey with lush synth sounds
embark on ethereal journey with lush synth sounds
golden hour dreams
01:03160 BPMC major
chillwavedreamwavedreamysynthesizer
achieve serene peace through synths and dreamy soundscapes
achieve serene peace through synths and dreamy soundscapes
cosmic sunset vibes
01:5595 BPME major
chillwavedreamwavedreamysynthesizer
dreamy synths and soft echoes evoke midnight introspection
dreamy synths and soft echoes evoke midnight introspection
nocturnal echoes of dreams
01:3290 BPMF# minor
synthpopdreamwavedreamysynthesizer
haunting, atmospheric synths blend with dreamlike, echoing melodies
haunting, atmospheric synths blend with dreamlike, echoing melodies
ethereal midnight synthwave dream
01:47150 BPMC major
synthpopdreamwavedreamysynthesizer
soft synth waves evoke tranquil and dreamy twilight vibes
soft synth waves evoke tranquil and dreamy twilight vibes
serene twilight melodies
01:3280 BPMC major
synthwavedreamwavepeacefulsynthesizer