Free Ambient Basslines Stock Music
ominous basslines with an eerie, funky twist.
fusion of soulful basslines and raw punk guitar energy.
heavy basslines with aggressive hip hop inspired lofi textures
heart racing soulful punk maintaining an intense suspenseful atmosphere
tense and soulful punk with a suspenseful twist
cumbia groove intensifies gripping jungle escape sequence
pumping synths and bass with empowering electronic rhythms
harmonious rhythms with comforting nighttime vibes
smooth, energetic grooves with funky, loving undertones
futuristic dubstep with driving bass and energetic drops
high energy pulsating beats driving intense techno soundscape
pulsating beats driving an intense techno experience
energetic and lively electronic dance track
menacing and ominous trap beat
pulsating beats and mesmerizing synths
electric city after dark
out of this world basslines and vibrant electronica beats energize
deep bass under neon sky narrative
soundtrack for the haunted cityscape.
intense guitar with deep, sinister undertones
glittering beats that uplift and spark joy
vintage beats meet groovy basslines, pure retro joy
deep basslines and eerie synths evoke urban nightscape
intricate basslines and engaging rhythms for a dynamic experience
thrilling basslines, eerie synths, and edge of seat rhythms
smooth r&b vibes with euphoric synth and basslines.
soulful funk with sensuous basslines and captivating riffs
heavy basslines with egyptian motifs and dark beats.
groovy basslines, eerie synths, funky rhythmic beat.
bouncy dub rhythms with groovy basslines and chill vibes
groovy basslines meet sorrowful, melancholic melodies serenely
eerie, dark, urban phonk with haunting basslines
blending groovy basslines and sadcore melodies for impact.
a fusion of funky basslines with melancholic melodies.
smooth beats with deep basslines and sultry melodies.
deep basslines, syncopated rhythms, and neon lit urban soundscapes
hypnotic rhythms, deep basslines, and misty urban ambience
relaxing beats with smooth guitar and funky basslines.
upbeat, groovy track with funky basslines and retro vibes
funky basslines with eerie nighttime ambiance.
energetic middle eastern melodies with funky basslines
ethereal disco funk with hypnotic beats, soulful basslines.
intense guitars and relentless drums with heavy basslines
rebellious and energetic track highlighting intense punk basslines
where discipline collides with groove.
energetic beats meet smooth, funky basslines
aggressive basslines and punchy drums combine
sultry beats meet brooding basslines
groovy and eerie hybrid track of haunted beats
atmospheric beats weaving love's tranquil emotive tapestry
AI PhotosYouTubeguitarfestivevictory anthemfunkaispooky funkreflectivesynthesizertranquilsoftacoustic guitarupbeatvibrantepicdancechristmas musicclassicalanimesynthwavespanish guitar