Free Battle Within Stock Music
energetic blend for animated adventure
orchestral metal tones summon ancient spirits
a symphonic metal masterpiece
captivating power anthem
power and momentum
powerful and majestic instrumental metal track
orchestra swells in moonlit mythical battles
energetic orchestral soundtrack for peak anime battle scenes
epic symphony depicting heroism in legendary battles
electric violin brings celtic tales to life again
explores bossa nova's angrier, more volatile emotional depths
angry tones meet chilled beats.
symphonic journey through lore and legend
energetic theme for anime character ultimate battling sequence
guitars whisper tales of forgotten battles
epic rock anthem celebrating ancient battles
soundtrack for a mythological tale
epic orchestral symphony depicting cosmic battles and valor.
epic orchestral piece depicting spacescapes and mythical battles.
powerful orchestration depicting legends and battles, grandiosity intact
orchestral epic unveiling heroes' journey amid legendary battles.
inspiring grand orchestral piece, heroic triumph in battles
fast paced bold instrumental inspired by urban street battles
heroic journey through adventurous landscapes and fierce battles
sweeping orchestral piece of heroic glory and mythic battles
mystical chants meet military precision.
flamboyant neon future with dramatic samurai duels under moonlight
thrilling orchestral epic with dramatic builds and heroic melodies.
intense, primal, powerful beats with fierce tribal energy.
a grand orchestral piece with intense dramatic sequences
dark and intense with an electric guitar lead
aggressive and rhythmic basslines drive this energetic track
majestic overture blending orchestral and electronic elements dramatically.
traditional middle eastern percussion with driving, intense rhythms
metallic soundscapes convey intensity of interstellar combat.
epic clash of thundering operatics, aggressive and grandiose
heavy beats, fierce flow, raw urban atmosphere, relentless energy
epic, fast paced, aggressive metal with relentless energy.
aggressive folk rock: traditional melodies, electric riffs, dynamic rhythms
calming military inspired piece with gentle rhythms and atmospheric textures
epic orchestral piece with intense, dramatic, angry tones
driving beats symbolize military confrontation in intense warfare
intense, driving rhythm evoking military confrontation
modern showdown vibes with fiery electric guitar and drums
intense, epic, and furious orchestral cinematic instrumental composition.
epic metal anthem celebrating victory and heroism loudly
unleashing intense energy through primordial beats and chants.
celestial warriors clashing amidst the galaxies.
electronic war beats with eerie futuristic soundscape elements
AI PhotosYouTuberockdholjazzdramaticanime instrumentalplayfulupliftinghopefulsynthesizernature soundspunksynthwaveminimalistclassicalatmosphericorchestralrelaxingurbanemotionalelectric guitar