Free Celestial Synth Stock Music
enigmatic piece conjuring gothic, cosmic soundscapes.
blends infectious grooves with ethereal, spacey elements perfectly
serene and gentle journey through spatial realms with synths
a journey through a futuristic, ethereal soundscape of dreams.
ambient soundscapes intertwine to create an ethereal atmosphere
imaginary beings unite in an intergalactic dance off.
a cosmic dream pop sonic adventure creates thrilling sensations
inspiring soundscapes leading listeners through celestial realms
a serene journey through celestial soundscapes and floating melodies.
soothing lounge sounds from an otherworldly domain beyond stars.
a mystical journey blending disco funk with spiritual vibes
transcendent bliss in spiritual, otherworldly electronic atmospheres
journey through the unending expanse of galactic wonder
hypnotic melodies with punchy rhythm and celestial undertones
magic infused soundscape enveloping listeners in whimsical transcendence
gentle dream pop ambiance with relaxing, lush melodies
surreal, ethereal blend of gospel with cosmic psychedelic tones.
a mesmerizing journey through otherworldly realms
celestial harmonies echoing through vast interstellar voids
the birth of worlds through sound
soothing ambient track, celestial themes with ethereal tranquility
intense guitar riffs with cosmic synths and rapid rap
gentle lullaby evoking dreamy, celestial, peaceful, and otherworldly feelings
uplifting acoustic guitar blending alien emotions and celestial vibes
majestic and haunting melody, a somber celestial journey
gentle guitars and cosmic synths create dreamy soundscapes.
soothing progressive rock blending intricate guitar and soft synths
majestic, atmospheric sounds create a celestial, reflective mood.
uplifting melodies with celestial, hypnotic, and serene trance essence
uplifting progressive rock evoking celestial travel inspirations.
suspenseful rock journey with shadowy guitar riffs and synths.
intense celestial battle with furious instrumental peaks
a joyful mix of celestial soundscapes and tribal beats
nature's secrets told in celestial whispers; dreamscape adventure
instrumental gospel infused with celestial and ethereal otherworldly elements
ethereal waltz intertwined with celestial and dreamy elements.
ethereal and rhythmic beats creating magical salsa dreamscape
haunting orchestral electronic blend, an emotional galactic voyage
cosmic disco beats marrying ethereal and vibrant funk elements.
enchanting melodies creating a serene, uplifting atmosphere
AI Photospunjabi bhangragospelcreepy circussitar and tablaraag bhairaviopening ceremonyindian instrumentalhotex fundarkwavemysticalhindianimeelectronicinstrumental gospelchildren s musicupliftingpunjabi beatsindianindian musiccinematic