Free Dissonant Baroque Stock Music
fusing traditional baroque with unexpected rebellious guitar riffs
vivacious dance tune capturing baroque ballroom excitement.
intense baroque piece with powerful and dramatic dynamics guaranteed!
ethereal baroque symphony merging celestial and delicate tones
gentle melodies with playful yet intimate nuances.
evoke a serene, timeless baroque calm ambiance
haunting melodies in a dark baroque atmosphere
exquisite blend of baroque elements and smooth rhythms.
uplifting prelude celebrating joy and boundless celebration through music
funky beats meet intricate baroque arrangements delightfully
lighthearted baroque piece evoking whimsical, joyful court dances
dramatic baroque music with heightened sense of urgency
discordant harpsichord and strings create chilling atmosphere.
reflective baroque sequence with timeless, deep contemplations.
introspective baroque melody with deep, reflective undertones.
cosmic fusion of baroque elegance and futuristic rhythms.
uplifting baroque tune blending royal elegance and energy
dark orchestration with contemporary grit and historical roots
livelier baroque melodies for a sunny garden morning
transport listeners to an otherworldly dreamscape, pure instrumental sophistication.
euphoric and grand baroque piece with intricate harmonies
elegant, cheerful baroque composition with sunny, joyful energy
elegant baroque themes inspiring heartwarming and serene feelings
intense baroque composition with powerful, stormy elements
composition that chills to the bone
dark, experimental piece evoking fear through unsettling, haunting melodies
eerie instruments weave dark melodies in a haunting atmosphere.
glitchy melodies twist within dark, ethereal electronic soundscapes.
an instrumental goth song with chaotic, dark, haunting atmospheres.
an unsettling ambient piece with haunting, dissonant soundscapes
a tense electronica track embodying the pulse of anxiety.
a chilling fusion of industrial sounds and eerie melodies.
an intense darkwave track weaving chaos and deep shadows together
a haunting journey through dark soundscapes and chaotic rhythms
anxious strings weave unsettling melodies evoking impending unknown peril.
a haunting instrumental mambo with eerie unsettling melodies
an eerie jazz piece featuring dissonance and unsettling melodies
chaotic instrumental opera with dramatic pipe organ crescendos
an explosive classical piece with dissonant melodies and rapid shifts.
haunting sounds echo through dark halls of abandoned asylum
an unsettling instrumental polka with dark, eerie, haunting tones
an aggressive instrumental blending patriotic motifs with chaotic sounds
an epic instrumental symbolizing rebirth and triumph over challenges
an intense piano composition filled with dissonance and aggression
baroque melodies fused with futuristic synths in an instrumental masterpiece.
baroque strings evoking a melancholic winter's solemnity
ornate baroque orchestration conveys royal love and passion.
intricate and whimsical harpsichord for dreamy classical journeys
intricate harpsichord melodies evoking deep emotional reflection and yearning
exotic complexity meets baroque elegance and delicate mystery
AI Photossitar and tablachristmas musicpunjabi bhangrapeacefulchristmas phonkdancerhythmicsynthwaveelectronicchristmastraditional koreanfreesound effectsdark ambienthard technobossa novamysteriousgospel instrumentalbeatchristmas classical