Free Distortion Pedals Stock Music
brutal black metal track with heavy distorted guitars and blastbeats
pulsating synths with a creepy, futuristic vibe
pulsating beats with dark synthetic, industrial melodies
eerie and distorted grunge with chilling, unsettling tones
intense beats with aggressive synths, furious tempo, dark undertones.
distorted, eerie, and intensely powerful black metal composition
dark, unsettling, and experimental garage sound with eerie echoes
dark, eclectic, and edgy with gritty urban vibes
chilling metal with eerie, menacing undertones throughout track.
aggressive experimental journey through dystopian industrial chaos
an eerie and unsettling instrumental doom metal track
a haunting and unnerving musical journey into a nightmarish circus
a haunting and heavy nu metal instrumental
high energy skate punk instrumental for an action sequence
a brutal death metal instrumental with relentless blast beats
a sinister and unsettling instrumental piece
a sinister and unsettling trap instrumental with eerie carnival elements
gritty and atmospheric instrumental phonk track
an aggressive and powerful nu metal instrumental
a heavy, aggressive metal track with an ominous atmosphere
industrial power with futuristic atmosphere, deeply intense experience
eerie synths with a pulsating, unsettling rhythm groove
unnerving mechanical sounds in an unsettling industrial landscape
rhythmic anxiety with modern and traditional african sounds.
unrelenting experimental sound with intense dissonant industrial elements
spiraling sounds create a chilling soundscape
intense and heavy metalcore track with aggressive rhythms
a haunting and unsettling carnival ride through a twisted nightmare
a trippy psychedelic rock instrumental with heavy riffs and distorted guitars
experience raw sorrow through distorted guitar riffs.
chilling resumes in abandoned northerly landscapes
dark, gritty, and relentless instrumental
brutal death metal track with relentless blast beats and shredding guitars
heavy and aggressive dubstep track with eerie atmosphere
an eerie and unsettling instrumental piece
a high-energy, aggressive punk instrumental
a gritty, relentless industrial rock instrumental
an intense and aggressive metalcore track
a brutal, heavy metal instrumental evoking the horrors of hell
a dark, aggressive heavy metal trap fusion
a haunting and oppressive instrumental track
an intense blend of heavy metal and trap
a dark and menacing phonk beat with a hard-hitting bassline
a pulsing, gritty industrial rock track with a relentless beat
a brutal and relentless heavy metal instrumental
disturbing 80s vibes with nostalgic, haunting synthesizer echoes
haunting echoing guitar in dark mysterious setting
dark alley with haunting grunge guitar riffs
eerie toys orchestrate unsettling creepy nightmarish childhood memories
heavy riffs meet melancholic melodies, embracing profound sadness
AI PhotosYouTubejazzviolinhauntingmelancholicenergeticchristmasegyptiandarkplayfuldark ambientatmosphericcheerfulintrospectivenature soundscapeworldclassicalancient egyptianphonknature soundsdramatic