Free Gentle Lullaby Stock Music
romantic goth lullaby with haunting piano motif
soft, soothing grooves lull babies to sleep.
eerie, ghostly serenade with haunting nighttime whispers
a soothing and magical lullaby that transports the listener to a mystical forest
a peaceful lullaby inspired by the sounds of a tropical rainforest.
a soothing tune blending futuristic sounds with classic lullaby.
calm and whimsical tune with childlike wonder
soothing sounds for serene sleep
soothing harp serenades wrapped in ambient night whispers
gentle melodies soothe the soul, promising brighter tomorrows
soothing tones for gentle children's sleep.
an intense lullaby blending calm and power beneath stars
soft harp melodies under gentle, glowing night sky
gentle melodies transport listeners to magical woodland nights
ethereal tones embrace timeless nocturnal serenity.
an instrumental lullaby invoking serenity through heavenly harp melodies
a soothing lullaby blending japanese shakuhachi with ambient textures
a tender tune for serene, dreamy, restful nights
eerie melodies weaving through spectral lullabies
soothing melody for peaceful sleep.
a soothing and dreamy lullaby for a peaceful slumber
soothing melody, guiding children to a peaceful sleep
soft melody comforting children, perfect for bedtime routines.
instrumental lullaby guiding introspective journey under tranquil night skies
delicate harp strings create soothing dreams beneath the starlit sky
soft, quiet music for calming night time musings.
enchanting space lullaby with soft twinkling melodies
soft beats blending with night sounds.
soothing tones for deep relaxation
a soothing nursery melody
a soothing and dreamy lullaby that transports the listener to a magical forest
soothing tones blend into night's quiet symphony
soothing sounds for tranquil reflection.
blissful children's melody for unwinding before sleep
gentle celestial melody floating through tranquil night sky
bittersweet nursery rhyme with dreamlike, haunting touch
harmonious notes float in a starlit sky
soothing tones to invite peaceful slumber
soothing tones under starry skies
a soothing and calming instrumental lullaby
soft lullaby reawakening fond childhood memories with tender melodies.
delicate melodies for serene, romantic bedtime experiences.
powerful, evocative nighttime harp melody
soothing yet melancholic nursery rhyme tune
a soothing and enchanting lullaby that transports the listener to a magical forest
an eerie lullaby weaving through mysterious, shadowed dreamscapes
encouraging tunes gently embrace children, easing them into dreams
a soothing melody for peaceful slumber
gentle echoes of nocturnal waves soothing baby's dreams
a tender lullaby with whispering melodies for lovers
AI Photosraag bhairavisynthwaveenergeticindianfreepunjabi bhangraindian classical fusion100 bpmindian instrumentaltorrentinstrumental jewishsharemixer xtx fusion acoustic resistancenaa telugu mp3 songs download freetibetan fluteclassicalscottishepicjoyfulviolinaudio