Free Haunting Motif Stock Music
eerie blend of haunted motifs and spiritual undertones
abstract embrace of suspense and shadows in music
triumphant theatrical cabaret with a gothic, dark undertone
cosmic echoes of russian sailors voyaging through the universe.
eerie melodies twining through archaic folk tales.
mysterious melody from ancient arabian nights.
eerie melodies under a full moon
instrumental merging dark cabaret with uplifting, hopeful melodies.
solo harp unveils layers of ancient tales
haunting melodies interwoven with delicate, mysterious piano themes.
suspenseful sounds inspired by gothic carnival cabaret melodies.
intense neoclassical piece blending egyptian motifs with urgency
gentle, calming, reflective ambience music
ominous dark journey through mystic middle eastern landscapes
dark synthwave instrumental merging egyptian motifs with 80s electronica
ethereal sounds combine with stirring rhythmic motifs
an instrumental blending jewish motifs with eerie ambient textures
merges eerie string quintet with unsettling electronic textures
haunting melodies with eerie circus inspired cabaret rhythms.
intense neoclassical composition merging egyptian motifs into dramatic melodies
eerie western instrumental with haunting melodies over ambient textures.
a tense lullaby merging eerie tones with soothing melodies.
haunting journey through enthralling, dark middle eastern soundscapes
sinister romance unfolds through ominous, haunting melodies.
soft piano under moonlit darkness
haunting melodies evoke nostalgic, melancholic summer nights.
romantic instrumental weaving world ethnic sounds of heartfelt longing
eerie soundscape invoking nocturnal mystery and calm
samba rhythms intertwined with eerie, haunting sounds
a somber cinematic piece evoking lost memories and distant lands
mesmerizing raga rock instrumental expressing profound yearning and introspection
histories whisper through this enigmatic piece
dark, dissonant instrumental with layers of sorrowful melodies.
ancient meets modern in timeless symphony
melancholic instrumental of russian sailor's solitude amid arctic seas.
an eerie ambient tune that haunts deserted, silent places
melodies echo, creating suspenseful shadows
mysterious capriccio blending ancient motifs with modern dramatic flair
orchestral piece with rising tension, revealing hidden secrets
an intense capriccio merging timeless themes with contemporary drama
dark anime motif, enveloped in tension and mystery
ominous lullaby with a haunting and eerie tone
eerie dub blend with mysterious and dark undertones
orchestral sounds haunting old mansion vibes
a haunting baroque piece expressing solitude through harpsichord melodies
a haunting and introspective piano piece
transporting listeners through mystical, untouched terrains
ancient meets modern in haunting harmony
haunting urban atmosphere captured in sound
e minor haunts, a melancholic auditory journey
AI Photoslofirapegyptianhindicalmfreeenergeticviolindark circuspopclassicaljoyfulambientindigenous australianelectric guitarbollywoodpopularpunjabi beatsindiagraduation processional