Free N A Stock Music
aggressive dark beats, urban chaos with underground vibes.
epic buildup, thunderous drums, mesmerizing beats
electronic beats merge urban soundscapes.
energizing beats for late night work.
playful drum & bass with quirky melodies and bouncy beats.
an epic drum and bass track showcasing intense rhythmic energy.
high energy beats racing through neon lit futuristic urban landscapes.
mysterious basslines with ethereal ambient textures surround you.
motivational and fast paced track with energizing beats
spiritual sounds meet rapid drum beats
mystical beats meet modern rhythms.
driving beats under melancholic melodies
turbocharged drum sequence elevates the rush.
lush and vibrant rhythms with pulsating energy.
uplifting beats energize the early morning soundscape
energetic rhythms, morning vibes uplift spirits daily.
deep emotional beats in energetic tune.
sink into evening's calm with mellow rhythms
dynamic rhythms, potent neurofunk elements
energetic beats, thrilling bass lines converge
energetic morning vibes in urban style.
an energizing fusion of rhythm and melody inspiring inner strength.
atmospheric drum and bass track conveying deep sadness and longing
eerie synths meld with relentless darkstep beats; haunting atmosphere
fast paced, energetic, powerful drum and bass experience
atmospheric blend of jungle rhythms and ethereal ambiance
refined rhythms for evening relaxation
mysterious beats, depths explored musically
immerse into deep, dark, rhythmic neurofunk
energetic, joyful drum and bass instrumental.
fast, pulsating beats accelerate through soundscapes.
mystic drums collide with haunting bass lines.
uplifting melody that starts your day right
an energetic drum and bass track with hopeful soaring melodies
mechanical beats meet nature's sounds in an energizing fusion
deep beats explore inner thoughts in rhythmic ambient flow.
an empowering drum and bass anthem bursting with positive energy.
otherworldly beats blended with deep cosmic bass sounds
pulsating beats and energetic rhythms with vibrant basslines
echoes of sadness in drum'n'bass rhythms
urban beats meet lush soundscapes.
darkness resonates with deep drums
feel the pulse of the city wake up
gentle sax with powerful beats.
beat driven soundtrack for productive nights.
sultry basslines intertwine with lush rhythms in nocturnal soundscape
atmospheric drums blend with gentle melodies for deep relaxation
an ethereal blend of beats and melodies under starlit skies.
festive drum and bass fusing samba rhythms and electronic beats
surreal rhythms and dreamlike textures blending into trance
AI Photosboom bapfolkhappydark ambientviolinindian instrumentalpunjabi beatsegyptiancinematicchillwavebairanreflectiveanime fightpunjabi folkheavy metaljazzsynthesizerhindigraduation processionalindian