Free String Instrument Stock Music
powerful orchestral music brimming with raw, vengeful intensity.
romantic elegance with a lively spirited touch
reflective baroque sequence with timeless, deep contemplations.
introspective baroque melody with deep, reflective undertones.
bitter cold winds whispering through empty, barren landscapes.
reflective, somber, and intricate sadcore with elegant piano melodies
calm and soothing dawn with gentle guitar melodies
nostalgic yet lively, heartwarming string melodies and dynamic rhythm.
orchestra in the forgotten world's heart
traditional melodies meet modern harmonies.
an energetic blend of urban beats and emotive melodies
a haunting melody longing for times lost and love yearned
an ambient ballad inspired by serene japanese garden evenings
an instrumental symphony invoking peace, harmony, and hopeful longing.
festive rhythms of a west african harvest celebration
an instrumental r&b track with dramatic strings and piano melodies.
sultry strings weave tales of passion and clandestine meetings.
somber strings weaving through shadows of forgotten grandeur
gentle breezes through rustling autumn leaves in dreams
haunting strings entwined with dark, introspective guitar lines
vibrant harpsichord driven piece with elegant chamber strings
uplifting, festive baroque symphony with lively harpsichord solos
instrumental music evoking retrospective sadness with vintage soundscapes
elegant strings evoking bittersweet baroque era summer emotions
orchestral fusion capturing ancient stories
transcending time through melodic fusion.
an energetic baroque piece radiating happiness and festive spirit.
a dreamlike fusion of ambient synths and traditional strings
an intense baroque piece with aggressive rhythms and powerful melodies
a suspenseful gospel instrumental blending organ and strings
an instrumental cinematic piece evoking deep feelings of melancholy.
veena echoes across calm, mystical waters at dusk
orchestral strokes celebrate moments of grandeur.
mournful, slow latin instrumental with deep, evocative melodies.
gentle folk melody with intricate harmonies and lush strings
powerful blend of rock and orchestral elements
joyful blend of strings and electronic dance elements.
heartfelt anime music evoking deep sorrow and melancholy.
rhythmic flute summons ancestral spirits at night
oceanic echoes reflect ancient, submerged secrets.
gentle strings evoke passion in romantic classical melodies.
gentle harp plays, evoking deep emotional bonds
an epic instrumental journey celebrating freedom and boundless skies
melancholic guitar melodies in a deep, reflective latin bolero.
melodies echoing across snowy, starlit landscapes
gentle strings express yearning in sensual classical compositions.
ancient tales manifest in melodic arabian winds
minimal notes create deep emotional landscapes
orchestral comedy with a playful twist
AI Photosbollywooddholphonkjazzbeatenergeticviolinmovie soundtrackshappynostalgictalking drumhip hopfunkpicnicreflectiveegyptianindian classicalsad gospel instrumentalcorporatemoroccan