StockTune: Free stock music and songs
StockCake: Free AI stock photosAI Photosinstrumental gospelpunjabi folk90 bpmdark ambientanimeturkish sazmp3 downloader juice free musicjoyfulworldreggaemilitary paradec majornostalgicindiaindian musicpianoinstrumentalheavy metalindian classicaljazz
Immerse in an ethereal realm where dark, ambient textures intertwine with hauntingly beautiful melodies, creating an inspiring goth sonic journey that evokes otherworldly emotions.
Public DomainAI Generated

Ethereal Midnight Dreamscape

Dark Atmospheric Backdrop With Hauntingly Beautiful Melodies.

120 BPME minor01:24

Immerse in an ethereal realm where dark, ambient textures intertwine with hauntingly beautiful melodies, creating an inspiring goth sonic journey that evokes otherworldly emotions.

electric guitargothdarkwavemysteriousenchantingmajesticgothicetherealdarkwaveatmospherichauntingelectric guitarinspiringmysteriousotherworldly

Related Tags

hauntinghauntinggothicgothicetherealetherealatmosphericatmosphericdarkwavedarkwavemysteriousmysteriouseerieeerie120 bpm120 bpmambientambientdarkdarkshadowyshadowymelancholicmelancholic

Similar Stock Music

gothic melodies intertwined with electric rhythms, vibrant sound adventure
gothic melodies intertwined with electric rhythms, vibrant sound adventure
haunted electric fairground
01:35140 BPMA minor
gothdarkwavehauntingelectric guitar
dark atmospheric sounds with hauntingly surreal undertones.
dark atmospheric sounds with hauntingly surreal undertones.
eclipsed midnight reverie
01:55115 BPMG minor
gothdarkwavenostalgicsynthesizer
eerie echoes meet sultry, dark melodies.
eerie echoes meet sultry, dark melodies.
whispers in gothic halls
01:55125 BPMD minor
gothdarkwavemysteriouschurch organ
dark ethereal melodies mixed with deep haunting textures.
dark ethereal melodies mixed with deep haunting textures.
veil of shadows
01:41180 BPMA minor
gothdarkwavenostalgicsynthesizer
gothic ambience with deep, contemplative musical expressions.
gothic ambience with deep, contemplative musical expressions.
eternal shadowy reflections
01:57120 BPME minor
gothdarkwavemelancholicelectric guitar
dark tones meld with powerful beats.
dark tones meld with powerful beats.
shadows within silence
01:42120 BPMD minor
goth rockethereal wavemysteriouspipe organ
enigmatic piece conjuring gothic, cosmic soundscapes.
enigmatic piece conjuring gothic, cosmic soundscapes.
ethereal nightfall
01:08125 BPMA minor
gothdarkwavemysterioussynthesizer
organ tones craft haunting, mystical atmospheres.
organ tones craft haunting, mystical atmospheres.
echoes through ancient vaults
01:34155 BPME minor
gothdarkwavemysteriouschurch organ
eerie, ethereal, and haunting, this trippy goth instrumental captivates
eerie, ethereal, and haunting, this trippy goth instrumental captivates
trippy gothic nightshade
01:29130 BPMC minor
gothgothic rockeeriesynthesizer
dark, ethereal soundscapes reflecting an eerie midnight symphony
dark, ethereal soundscapes reflecting an eerie midnight symphony
haunted midnight echoes
01:4580 BPMD minor
ethereal wavedarkwavemysterioussynthesizer
mysterious, haunting synths echo in brooding darkwave journey
mysterious, haunting synths echo in brooding darkwave journey
echoes of dark abyss
01:50120 BPMA minor
darkwavegothic darkwavemysterioussynthesizer
hauntingly atmospheric track with eerie, hypnotic undertones.
hauntingly atmospheric track with eerie, hypnotic undertones.
eclipsed nocturnal whispers
01:48120 BPME minor
darkwavegothic darkwaveeeriesynthesizer
mysterious, ambient track with deep, resonant shadows
mysterious, ambient track with deep, resonant shadows
nocturnal gothic serenade
01:29140 BPMA minor
darkwaveneoclassical darkwavemysterioussynthesizer
haunting gothic instrumental
haunting gothic instrumental
whispers of the forgotten
01:58130 BPME minor
rockgothsinisterelectric guitar
ominous gothic ambiance entwined with chilling melodies
ominous gothic ambiance entwined with chilling melodies
haunting shadows dark descent
01:26110 BPMD minor
gothdarkwavesinisterelectric guitar
haunting, atmospheric track with deep, resonant undertones
haunting, atmospheric track with deep, resonant undertones
moonlit gothic elegance
01:56110 BPME minor
darkwaveneoclassical darkwavemysterioussynthesizer
unnerving ambiance with ethereal waves and haunting undertones
unnerving ambiance with ethereal waves and haunting undertones
haunting starry night
01:52120 BPMA minor
ambientethereal waveunnervingsynthesizer
deep, dark, trippy, otherworldly, eerie instrumental goth soundtrack
deep, dark, trippy, otherworldly, eerie instrumental goth soundtrack
hallucinatory gothic shadows
01:32105 BPMB minor
gothgothic rockeeriesynthesizer
ethereal melodies with intense dark atmospheric undertones
ethereal melodies with intense dark atmospheric undertones
haunted midnight shadows
01:59145 BPMA minor
gothdarkwaveetherealsynthesizer
hauntingly mesmerizing landscapes echoing through dark night
hauntingly mesmerizing landscapes echoing through dark night
gothic moonlit silent whispers
02:0080 BPMC minor
ethereal wavedarkwavemysterioussynthesizer
haunting melodies weave through gothic shadows, invoking mystic realms.
haunting melodies weave through gothic shadows, invoking mystic realms.
enchanted midnight waltz
01:39130 BPMB minor
gothdarkwavemysteriouscello
melodic darkness infused with powerful atmospheric elements.
melodic darkness infused with powerful atmospheric elements.
nocturnal eclipse serenade
01:56120 BPME minor
darkwavegothmysterioussynthesizer
haunting melodies meet electric bursts, gothic vibrancy throughout
haunting melodies meet electric bursts, gothic vibrancy throughout
electric midnight carnival
01:35160 BPMF major
gothdarkwavehauntingelectric guitar
gleaming tones under a brooding atmosphere.
gleaming tones under a brooding atmosphere.
shadows sparkle in dark
01:54120 BPMC minor
goth rockglittermysteriouselectric guitar
ambient goth soundscape with haunting, hypnotic, otherworldly melodies
ambient goth soundscape with haunting, hypnotic, otherworldly melodies
trippy shadowscape nocturne
01:55150 BPME minor
gothdarkwavemysterioussynthesizer
**epic journey through shadows with mysteriously haunting melodies.**
**epic journey through shadows with mysteriously haunting melodies.**
**gothic shadows unveiled**
01:34120 BPMA minor
**goth****darkwave****mysterious**violin**
deep, bold rhythms with an ethereal, haunting goth soundscape.
deep, bold rhythms with an ethereal, haunting goth soundscape.
haunting gothic symphony
01:3790 BPMD# minor
gothdarkwavehauntingsynthesizer
dark melodies with an atmospheric haunting energy
dark melodies with an atmospheric haunting energy
ethereal gothic enchantment
01:56125 BPMF minor
gothdarkwaveetherealsynthesizer
hauntingly beautiful, soft instrumental with tender, melancholic melodies.
hauntingly beautiful, soft instrumental with tender, melancholic melodies.
gothic embrace in shadows
01:30120 BPMA minor
gothethereal gothmelancholicpiano
dark soundscapes and ominous church organ echo.
dark soundscapes and ominous church organ echo.
echoes through darkness
01:27120 BPME minor
goth rockdarkwavesinisterchurch organ
menacing, brooding track with eerie darkwave undercurrents
menacing, brooding track with eerie darkwave undercurrents
dark gothic presence
01:50120 BPMA minor
gothdarkwaveominousguitar
a haunting symphony
a haunting symphony
eternal night’s embrace
01:58115 BPME minor
gothdarkwavemysteriouspiano
deeper chords play under the shroud of night.
deeper chords play under the shroud of night.
echoes beneath shadows
01:57115 BPMD minor
rockgoth rockbroodingelectric guitar
power surges through ethereal darkness.
power surges through ethereal darkness.
embrace the night shadows
01:47160 BPMA minor
goth rockethereal wavemysteriouspipe organ
soft echoes of midnight create haunting, ethereal soundscape
soft echoes of midnight create haunting, ethereal soundscape
midnight velvet echoes
01:38130 BPMA minor
ethereal gothdarkwavehauntingsynthesizer
a hauntingly beautiful, eerily ethereal sonic experience.
a hauntingly beautiful, eerily ethereal sonic experience.
haunted misty dreams
01:59120 BPME minor
ethereal waveetherealeerietheremin
dark, ethereal atmosphere with powerful, haunting melodies.
dark, ethereal atmosphere with powerful, haunting melodies.
shadowed gothic majesty
01:4985 BPMC# minor
gothdarkwavehauntingsynthesizer
haunting melodies in a desolate, eerie soundscape.
haunting melodies in a desolate, eerie soundscape.
ethereal shadows weep
01:08105 BPMA minor
gothdarkwavemelancholicpiano
an eerie soundscape beckoning listeners into the unknown.
an eerie soundscape beckoning listeners into the unknown.
whispers in shadow realm
01:52100 BPMA minor
darkwaveethereal wavesinisterelectric guitar
mysterious gothic instrumental
mysterious gothic instrumental
moonlit shadows beckon
01:58140 BPMC major
rockgothdarkelectric guitar
dark, trippy, ethereal soundscape with haunting gothic melodies
dark, trippy, ethereal soundscape with haunting gothic melodies
ethereal gothic reverie
01:4390 BPME minor
gothdarkwaveetherealelectric guitar
a hauntingly sensual goth instrumental with dark undertones.
a hauntingly sensual goth instrumental with dark undertones.
dark whispering shadows
01:55120 BPMA minor
gothgoth rockseductiveguitar
a dark instrumental exploring unseen worlds beyond mortal perception
a dark instrumental exploring unseen worlds beyond mortal perception
echoes from shadow realm
01:56135 BPMC minor
gothic rockdark ambientmysterioustheremin
ethereal tones echo through a surreal cosmic landscape
ethereal tones echo through a surreal cosmic landscape
cosmic radiant echoes
01:58120 BPMD minor
otherworldlyambientalientheremin
dark atmospheric tones with spiritual captivating chants
dark atmospheric tones with spiritual captivating chants
haunting spiritual soundscape
01:52120 BPMD minor
darkwavespiritual darkwavemysticaltheremin
a sad, instrumental piece evoking deep melancholy and mystery
a sad, instrumental piece evoking deep melancholy and mystery
weeping shadows of night
01:4885 BPMD minor
gothdarkwavemelancholicviolin
eerie, atmospheric, melodic darkwave transporting to an ancient realm
eerie, atmospheric, melodic darkwave transporting to an ancient realm
moonlit forest enchantment
01:45125 BPME minor
darkwaveethereal wavegothicsynthesizer
shadow filled melodies create a creepy, gothic atmosphere.
shadow filled melodies create a creepy, gothic atmosphere.
midnight’s gloomy accents
01:58155 BPMB minor
gothdarkwavesinisterelectric guitar
a dark instrumental weaving despair with haunting guitar melodies.
a dark instrumental weaving despair with haunting guitar melodies.
shadows fall eternal
02:00130 BPME minor
gothic rockdarkwavesinisterelectric guitar
slow, heavy chords echo in darkness.
slow, heavy chords echo in darkness.
whispers in the void
01:41160 BPME minor
rockgoth rockbroodingelectric guitar
an energetic instrumental goth song with dark, driving rhythms
an energetic instrumental goth song with dark, driving rhythms
requiem for fallen souls
01:19115 BPMC minor
gothic rockdarkwavedarkelectric guitar
melancholic tune evoking sorrowful memories and introspection
melancholic tune evoking sorrowful memories and introspection
haunted midnight tears
01:3690 BPME minor
gothdarkwavemelancholicviolin
ethereal melodies hovering over dark, hypnotic soundscapes
ethereal melodies hovering over dark, hypnotic soundscapes
mystical gothic dreamweaver
01:58120 BPMA minor
gothdarkwavemysteriouselectric guitar
enigmatic and haunting tunes enveloped in celestial whispers
enigmatic and haunting tunes enveloped in celestial whispers
fog veiled moonlight mysteries
01:58140 BPMA minor
ethereal waveambient gothicbroodingsynthesizer
dreamy gothic melodies with echoing guitars and haunting choirs.
dreamy gothic melodies with echoing guitars and haunting choirs.
gothic moonlight echoes
01:3290 BPMG minor
gothdream popetherealelectric guitar
an eerily beautiful, atmospheric, and captivating wave song
an eerily beautiful, atmospheric, and captivating wave song
haunted evening glow
01:57120 BPMA minor
ethereal waveambient waveenigmaticsynthesizer
haunting guitar riffs with ethereal atmospheric synth backdrops
haunting guitar riffs with ethereal atmospheric synth backdrops
midnight shadows dance darkly
01:52155 BPMA minor
goth rockdarkwavemysteriouselectric guitar
venturing into the heart of darkness with resonating strings
venturing into the heart of darkness with resonating strings
echoes in the dark
02:00135 BPMA minor
gothdarkwaveangryelectric guitar
a haunting melody sprinkled with scintillating, shimmering resonance.
a haunting melody sprinkled with scintillating, shimmering resonance.
glittering echoes of shadows
02:00155 BPMC minor
ambientetherealhauntingtheremin
a dark instrumental exploring despair amid haunting gothic soundscapes.
a dark instrumental exploring despair amid haunting gothic soundscapes.
haunting echoes of despair
01:55110 BPME minor
gothic rockdarkwavesinisterelectric guitar
dark, atmospheric vibes with eerie undertones
dark, atmospheric vibes with eerie undertones
shadows lurking in silence
01:44185 BPMA minor
goth rockdarkwaveeeriepiano
dreamy, eerie, and mysterious atmosphere with haunting melodies
dreamy, eerie, and mysterious atmosphere with haunting melodies
haunted midnight reverie
01:45140 BPME minor
dream popdark wavemysterioussynthesizer
mysterious ambient piece evoking gothic otherworldly atmosphere.
mysterious ambient piece evoking gothic otherworldly atmosphere.
celestial shadows descent
01:41100 BPMC minor
gothdarkwavemysterioussynthesizer
dark ambient tones meet dreamy, ethereal soundscapes.
dark ambient tones meet dreamy, ethereal soundscapes.
ethereal midnight depths
01:54120 BPMC minor
ambientdark ambientenigmaticsynthesizer
unraveling amid darkness, echoing chaos and gothic undertones
unraveling amid darkness, echoing chaos and gothic undertones
shadowy chaotic nocturnal symphony
01:49130 BPMC minor
darkwavechaotic darkwavebroodingsynthesizer
eerie synth waves creating dark, ethereal nighttime ambiance
eerie synth waves creating dark, ethereal nighttime ambiance
ethereal unnerving nocturne
01:49125 BPME minor
ambientethereal waveunnervingsynthesizer
intense gothic track with haunting, powerful melodic lines.
intense gothic track with haunting, powerful melodic lines.
midnight shadow waltz
01:5490 BPMG minor
gothdark wavebroodingelectric guitar
a hauntingly beautiful, ethereal journey through gothic soundscapes.
a hauntingly beautiful, ethereal journey through gothic soundscapes.
spectral dreamland serenade
01:49140 BPMB minor
gothdream popetherealelectric guitar
dark ambient, energetic tones pulsing within swirling soundscapes
dark ambient, energetic tones pulsing within swirling soundscapes
whirling abyss echoes
01:34120 BPMA minor
ambientdark ambienteerietheremin
an ethereal gothic journey through shadowy realms beyond reality
an ethereal gothic journey through shadowy realms beyond reality
whispers beyond mortal veil
01:31155 BPMB minor
gothic rockdark ambientmysterioustheremin
dark enigmatic soundscape
dark enigmatic soundscape
moonlit shadows cast
01:58110 BPME minor
gothdarkwavesinisterelectric guitar
unsettling atmospheric track that recreates haunted house sensations
unsettling atmospheric track that recreates haunted house sensations
echoes of forgotten souls
01:52120 BPMA minor
ambientdark ambienteerietheremin
haunting darkwave melodies with mysterious, eerie atmospheric rhythms.
haunting darkwave melodies with mysterious, eerie atmospheric rhythms.
eternal shadows enveloping
01:35125 BPMC minor
darkwavesynthwavemysterioussynthesizer
mysterious darkwave with haunting melodies and eerie rhythms.
mysterious darkwave with haunting melodies and eerie rhythms.
whispers through eternal shadows
01:30130 BPME minor
darkwavesynthwavemysterioussynthesizer
eerie tones under a ghostly moon's light
eerie tones under a ghostly moon's light
whispers of shadow night
04:00115 BPMF# minor
darkwavetrippyetherealtheremin
gothic and ethereal melodies create an otherworldly atmosphere
gothic and ethereal melodies create an otherworldly atmosphere
mysterious gothic dreamscape
01:45145 BPMB minor
gothethereal wavedarkelectric guitar
ethereal soundscape with dark, trippy undertones and haunting melodies
ethereal soundscape with dark, trippy undertones and haunting melodies
gothic dream sequence
01:51100 BPMC minor
gothdarkwaveetherealelectric guitar
enigmatic, dark melodies evoking otherworldly realms and emotions.
enigmatic, dark melodies evoking otherworldly realms and emotions.
mystic shadows dance
01:1095 BPMA minor
gothdarkwavemysteriouscello
a haunting blend of gothic and ethereal soundscapes
a haunting blend of gothic and ethereal soundscapes
ethereal shadows descend
01:46155 BPME minor
gothethereal wavedarkelectric guitar
ethereal darkwave creating mysterious, eerie, spiritual ambient soundscape
ethereal darkwave creating mysterious, eerie, spiritual ambient soundscape
otherworldly spiritual abyss
01:59120 BPMF minor
darkwavespiritual darkwavemysticalsynthesizer
subtle sound waves in haunting night atmosphere
subtle sound waves in haunting night atmosphere
moonlit mystique sonic escape
01:53115 BPMD minor
darkwaveethereal wavemysterioussynthesizer
a serene and otherworldly instrumental piece
a serene and otherworldly instrumental piece
celestial dreamscape
01:58120 BPMA minor
ambientetherealdreamyambient pads
haunting gothic instrumental with powerful, dark undertones.
haunting gothic instrumental with powerful, dark undertones.
labyrinth of eternal night
01:30130 BPME minor
gothdark wavebroodingelectric guitar
dark tones echo through a cavernous soundscape
dark tones echo through a cavernous soundscape
shadows loom large
01:04150 BPMG# minor
gothdarkwaveangryelectric guitar
soulful goth instrumental evoking deep emotions and haunting melodies
soulful goth instrumental evoking deep emotions and haunting melodies
whispers in the abyss
01:46120 BPMD minor
gothic rockdarkwavemelancholicelectric guitar
eerie melody swirls in shadowed mist
eerie melody swirls in shadowed mist
shadows whisper secrets
01:50120 BPMC minor
darkwavegothic ambientmysteriouspipe organ
ghostly echoes in cavernous depths
ghostly echoes in cavernous depths
echoes in the shadows
01:55120 BPME minor
goth rockethereal wavemysterioustheremin
eerie melodies echo through timeless silence
eerie melodies echo through timeless silence
whispers of the forgotten
01:27130 BPME minor
darkwaveneoclassical darkwaveeeriesynthesizer
dark, sinister melodies engulf twilight realms.
dark, sinister melodies engulf twilight realms.
shadows creep underneath
02:00120 BPMD minor
goth rockdarkwavecreepyelectric guitar
haunting melody evoking eerie, unsettling emotions, gothic echoes
haunting melody evoking eerie, unsettling emotions, gothic echoes
dark descent lamentation
02:00165 BPMA minor
gothdarkwaveominousorgan
raging tones meet ethereal, mystical soundscapes.
raging tones meet ethereal, mystical soundscapes.
fury in enchanted shadows
01:38120 BPMC minor
electronicdarkwaveangryelectric guitar
energetic goth instrumental blending dark melodies with vibrant beats
energetic goth instrumental blending dark melodies with vibrant beats
shadows dance under neon
01:55160 BPME minor
gothic rockdarkwaveenergeticsynthesizer
haunting melodies in a thrilling gothic soundscape journey.
haunting melodies in a thrilling gothic soundscape journey.
dark shadows chase light
01:3490 BPME minor
gothic rockdarkwaveominouschurch organ
tense atmosphere enveloped by gothic melodies.
tense atmosphere enveloped by gothic melodies.
shadows whisper secrets
01:55140 BPME minor
goth rockdarkwavesinisterchurch organ
whispering tones in a forgotten dreamlike landscape
whispering tones in a forgotten dreamlike landscape
echoes of silent shadows
01:59120 BPMG minor
ethereal waveominous wavemysterioussynthesizer
ethereal sounds from an otherworldly realm
ethereal sounds from an otherworldly realm
whispers of the void
01:45145 BPMA minor
ethereal waveambienteeriesynthesizer
dark, ambient soundscapes with gothic, mysterious elegance
dark, ambient soundscapes with gothic, mysterious elegance
enchanted gothic echoes
01:58120 BPME major
gothetherealetherealelectric guitar