StockTune: Free stock music and songs
StockCake: Free AI stock photosAI Photosambientelectric guitarinstrumental jewishbackground musiccinematicrap drumsserenesitarindian villageindiareflectiveepicindian classicalrockphonkhdhub4u movie download in hindi minstrumental reggaehinditemplegym phonk
An intense, instrumental gothic track that weaves haunting and powerful melodic lines to create a mysterious and immersive experience. The electric guitar's somber tones combined with atmospheric layers invoke a sense of wandering through the shadows of night.
Public DomainAI Generated

Midnight Shadow Waltz

Intense Gothic Track With Haunting, Powerful Melodic Lines.

90 BPMG minor01:54

An intense, instrumental gothic track that weaves haunting and powerful melodic lines to create a mysterious and immersive experience. The electric guitar's somber tones combined with atmospheric layers invoke a sense of wandering through the shadows of night.

electric guitargothdark wavebroodingdarkmysticalgothicdark waveelectric guitarhauntingbroodingpowerfulmelancholicmajesticetherealnight

Related Tags

hauntinghauntinggothicgothicetherealetherealatmosphericatmosphericdarkwavedarkwavemelancholicmelancholicbroodingbroodingeerieeeriedarkdarkmysteriousmysteriousreflectivereflectiveshadowyshadowy

Similar Stock Music

haunting gothic instrumental with powerful, dark undertones.
haunting gothic instrumental with powerful, dark undertones.
labyrinth of eternal night
01:30130 BPME minor
gothdark wavebroodingelectric guitar
dreamy gothic melodies with echoing guitars and haunting choirs.
dreamy gothic melodies with echoing guitars and haunting choirs.
gothic moonlight echoes
01:3290 BPMG minor
gothdream popetherealelectric guitar
gothic tones evoke deep melancholy under twilight's embrace.
gothic tones evoke deep melancholy under twilight's embrace.
midnight shadows lament
01:25180 BPMG minor
gothdarkwavemelancholicharp
dark atmospheric sounds with hauntingly surreal undertones.
dark atmospheric sounds with hauntingly surreal undertones.
eclipsed midnight reverie
01:55115 BPMG minor
gothdarkwavenostalgicsynthesizer
brooding, atmospheric composition with deep, resonant undertones.
brooding, atmospheric composition with deep, resonant undertones.
shadows of the abyss
01:5690 BPMF minor
darkwavegothic darkwaveeeriesynthesizer
gothic instrumental evoking eerie, mysterious night journey
gothic instrumental evoking eerie, mysterious night journey
haunted midnight echoes
01:2990 BPMA minor
gothdarkwavebroodingelectric guitar
dark, trippy, ethereal soundscape with haunting gothic melodies
dark, trippy, ethereal soundscape with haunting gothic melodies
ethereal gothic reverie
01:4390 BPME minor
gothdarkwaveetherealelectric guitar
a peaceful yet haunting travel through darkwave textures
a peaceful yet haunting travel through darkwave textures
hushed gothic nightfall
01:4780 BPMG minor
gothdarkwavemelancholiccello
dark ethereal melodies mixed with deep haunting textures.
dark ethereal melodies mixed with deep haunting textures.
veil of shadows
01:41180 BPMA minor
gothdarkwavenostalgicsynthesizer
hauntingly atmospheric track with eerie, hypnotic undertones.
hauntingly atmospheric track with eerie, hypnotic undertones.
eclipsed nocturnal whispers
01:48120 BPME minor
darkwavegothic darkwaveeeriesynthesizer
haunting guitar riffs with ethereal atmospheric synth backdrops
haunting guitar riffs with ethereal atmospheric synth backdrops
midnight shadows dance darkly
01:52155 BPMA minor
goth rockdarkwavemysteriouselectric guitar
a serene journey through eerie gothic soundscapes
a serene journey through eerie gothic soundscapes
midnight murmurs echo tranquil
01:59125 BPMC minor
gothdarkwavemelancholiccello
dark atmospheric backdrop with hauntingly beautiful melodies.
dark atmospheric backdrop with hauntingly beautiful melodies.
ethereal midnight dreamscape
01:24120 BPME minor
gothdarkwavemysteriouselectric guitar
eerie echoes meet sultry, dark melodies.
eerie echoes meet sultry, dark melodies.
whispers in gothic halls
01:55125 BPMD minor
gothdarkwavemysteriouschurch organ
organ tones craft haunting, mystical atmospheres.
organ tones craft haunting, mystical atmospheres.
echoes through ancient vaults
01:34155 BPME minor
gothdarkwavemysteriouschurch organ
gothic melodies arise in the melancholic veil of night.
gothic melodies arise in the melancholic veil of night.
haunting midnight whispers
01:5270 BPMA minor
gothdarkwavemelancholicharp
gothic synths weaving eerie melancholy soundscapes at midnight
gothic synths weaving eerie melancholy soundscapes at midnight
ethereal shadows looming dark
01:55130 BPMC minor
darkwaveethereal wavemysterioussynthesizer
gothic melodies intertwined with electric rhythms, vibrant sound adventure
gothic melodies intertwined with electric rhythms, vibrant sound adventure
haunted electric fairground
01:35140 BPMA minor
gothdarkwavehauntingelectric guitar
a dark goth instrumental enveloping listeners in haunting soundscapes
a dark goth instrumental enveloping listeners in haunting soundscapes
shadows embrace eternal night
01:46170 BPMA minor
gothic rockdarkwavedarkpipe organ
deep, bold rhythms with an ethereal, haunting goth soundscape.
deep, bold rhythms with an ethereal, haunting goth soundscape.
haunting gothic symphony
01:3790 BPMD# minor
gothdarkwavehauntingsynthesizer
eerie gothic vibes, haunting and mesmerizing, perfect ambiance.
eerie gothic vibes, haunting and mesmerizing, perfect ambiance.
ethereal darkened shadows
01:29110 BPME minor
gothgothic rockhauntingelectric guitar
hauntingly soft whispers in dark emotional landscapes
hauntingly soft whispers in dark emotional landscapes
whispering shadowed melancholy
01:33105 BPMC minor
gothethereal gothmelancholicpiano
haunting instrumental weaving gothic melodies through somber atmospheric soundscapes
haunting instrumental weaving gothic melodies through somber atmospheric soundscapes
echoes from shadowed depths
01:44140 BPMG minor
gothic rockdarkwavedarkpipe organ
ethereal melodies with intense dark atmospheric undertones
ethereal melodies with intense dark atmospheric undertones
haunted midnight shadows
01:59145 BPMA minor
gothdarkwaveetherealsynthesizer
haunting melodies in a thrilling gothic soundscape journey.
haunting melodies in a thrilling gothic soundscape journey.
dark shadows chase light
01:3490 BPME minor
gothic rockdarkwaveominouschurch organ
melancholic tune evoking sorrowful memories and introspection
melancholic tune evoking sorrowful memories and introspection
haunted midnight tears
01:3690 BPME minor
gothdarkwavemelancholicviolin
eerie resonance echoing through a shadow filled soundscape
eerie resonance echoing through a shadow filled soundscape
moonlit descent into darkness
01:16110 BPMD minor
goth rockdarkwavemelancholicelectric guitar
deep synths and eerie pads weaving melancholy midnight soundscapes.
deep synths and eerie pads weaving melancholy midnight soundscapes.
midnight gothic synthscape
01:58135 BPMA minor
darkwaveethereal wavemysterioussynthesizer
gothic ambience with deep, contemplative musical expressions.
gothic ambience with deep, contemplative musical expressions.
eternal shadowy reflections
01:57120 BPME minor
gothdarkwavemelancholicelectric guitar
ominous gothic ambiance entwined with chilling melodies
ominous gothic ambiance entwined with chilling melodies
haunting shadows dark descent
01:26110 BPMD minor
gothdarkwavesinisterelectric guitar
echoes of love amidst gothic night's veil.
echoes of love amidst gothic night's veil.
shadows embrace the night
01:27120 BPMB minor
darkwavegothic darkwavemysterioussynthesizer
haunting and dynamic, with spirited dark themed harmonies
haunting and dynamic, with spirited dark themed harmonies
dark spirited melodies
01:45185 BPMG minor
gothgoth rockbroodingelectric guitar
dark tones meld with powerful beats.
dark tones meld with powerful beats.
shadows within silence
01:42120 BPMD minor
goth rockethereal wavemysteriouspipe organ
melodic synths and beats intertwine, creating deep emotional landscapes.
melodic synths and beats intertwine, creating deep emotional landscapes.
shadows of forgotten love
01:4190 BPME minor
darkwaveethereal wavepassionatesynthesizer
dark romantic melodies weaving through timeless violin arrangements.
dark romantic melodies weaving through timeless violin arrangements.
elegance in gothic shadows
01:41110 BPMG minor
gothicclassical gothicmelancholicviolin
dark melodies with an atmospheric haunting energy
dark melodies with an atmospheric haunting energy
ethereal gothic enchantment
01:56125 BPMF minor
gothdarkwaveetherealsynthesizer
ethereal soundscape with dark, trippy undertones and haunting melodies
ethereal soundscape with dark, trippy undertones and haunting melodies
gothic dream sequence
01:51100 BPMC minor
gothdarkwaveetherealelectric guitar
haunting melodies with intricate darkwave layers under shadows
haunting melodies with intricate darkwave layers under shadows
gothic nightfall symphony
01:5385 BPME minor
darkwavesophisticated darkwavebroodingsynthesizer
power surges through ethereal darkness.
power surges through ethereal darkness.
embrace the night shadows
01:47160 BPMA minor
goth rockethereal wavemysteriouspipe organ
haunting echoes mingle with deep darkness
haunting echoes mingle with deep darkness
ghosts in velvet darkness
01:58110 BPMC minor
darkwavegothicmysterioussynthesizer
a sad, instrumental piece evoking deep melancholy and mystery
a sad, instrumental piece evoking deep melancholy and mystery
weeping shadows of night
01:4885 BPMD minor
gothdarkwavemelancholicviolin
ethereal echoes form mournful, evocative atmosphere
ethereal echoes form mournful, evocative atmosphere
shadows of silence
01:51135 BPMC minor
darkwavegothic darkwavebittersweetsynthesizer
haunting synth melodies enveloped in eerie darkwave ambiance
haunting synth melodies enveloped in eerie darkwave ambiance
whispering shadows arise
01:4090 BPMC minor
darkwaveethereal waveominoussynthesizer
shadow filled melodies create a creepy, gothic atmosphere.
shadow filled melodies create a creepy, gothic atmosphere.
midnight’s gloomy accents
01:58155 BPMB minor
gothdarkwavesinisterelectric guitar
a hauntingly beautiful, ethereal journey through gothic soundscapes.
a hauntingly beautiful, ethereal journey through gothic soundscapes.
spectral dreamland serenade
01:49140 BPMB minor
gothdream popetherealelectric guitar
gothic symphony evokes dark, passionate moods.
gothic symphony evokes dark, passionate moods.
midnight whispers in velvet
01:32130 BPMA minor
gothdarkwavemournfulviolin
sombre tones cascade in darkened corridors.
sombre tones cascade in darkened corridors.
echoes through the manor
01:56155 BPMG minor
goth rockdarkwaveetherealelectric piano
haunting reverberations echo with chilling gothic overtones
haunting reverberations echo with chilling gothic overtones
shadowed midnight cathedral
01:11130 BPME minor
gothdarkwavebroodingorgan
gothic melodies haunt the moonlit night
gothic melodies haunt the moonlit night
moonlit shadows dance
01:55150 BPME minor
goth rockdarkwaveetherealelectric guitar
dark enigmatic soundscape
dark enigmatic soundscape
moonlit shadows cast
01:58110 BPME minor
gothdarkwavesinisterelectric guitar
haunting melodies meet electric bursts, gothic vibrancy throughout
haunting melodies meet electric bursts, gothic vibrancy throughout
electric midnight carnival
01:35160 BPMF major
gothdarkwavehauntingelectric guitar
eerie melodies creating an ominous, haunting synthetic soundscape.
eerie melodies creating an ominous, haunting synthetic soundscape.
gothic shadows unveiled
01:1890 BPME minor
darkwavebold darkwavebroodingsynthesizer
**epic journey through shadows with mysteriously haunting melodies.**
**epic journey through shadows with mysteriously haunting melodies.**
**gothic shadows unveiled**
01:34120 BPMA minor
**goth****darkwave****mysterious**violin**
dark organ echoes fill solemn, gothic reverberating shadows
dark organ echoes fill solemn, gothic reverberating shadows
midnight gothic whispers
01:31140 BPMA minor
gothdarkwavebroodingorgan
intense darkwave infused with haunting melodies, pulsating beats
intense darkwave infused with haunting melodies, pulsating beats
haunting midnight rage
01:51160 BPMD minor
darkwavegothic rockangrysynthesizer
gothic ballad with soul, deeply emotional and haunting.
gothic ballad with soul, deeply emotional and haunting.
seraphic midnight melodies
01:58130 BPME minor
gothdarkwavemelancholicpiano
hauntingly beautiful, soft instrumental with tender, melancholic melodies.
hauntingly beautiful, soft instrumental with tender, melancholic melodies.
gothic embrace in shadows
01:30120 BPMA minor
gothethereal gothmelancholicpiano
echoing whispers fill the cathedral's dark hallways
echoing whispers fill the cathedral's dark hallways
cathedral echoes whisper
01:35155 BPME minor
goth rockdarkwaveetherealelectric guitar
pulsating darkwave track filled with intense haunting melodies
pulsating darkwave track filled with intense haunting melodies
midnight's haunting fury
01:56130 BPMB minor
darkwavegothic rockangrysynthesizer
menacing, brooding track with eerie darkwave undercurrents
menacing, brooding track with eerie darkwave undercurrents
dark gothic presence
01:50120 BPMA minor
gothdarkwaveominousguitar
haunting melodies with driving, dark themed harmonies throughout.
haunting melodies with driving, dark themed harmonies throughout.
spirited gothic echoes
01:5395 BPMC# minor
gothgoth rockbroodingelectric guitar
mysterious melodies with layered sophisticated darkwave soundscapes
mysterious melodies with layered sophisticated darkwave soundscapes
shadowed gothic reverie
01:31160 BPMD minor
darkwavesophisticated darkwavebroodingsynthesizer
dark, ethereal atmosphere with powerful, haunting melodies.
dark, ethereal atmosphere with powerful, haunting melodies.
shadowed gothic majesty
01:4985 BPMC# minor
gothdarkwavehauntingsynthesizer
dark, brooding textures sway under somber tones
dark, brooding textures sway under somber tones
shadows creep under moonlight
02:23140 BPMD minor
goth rockdarkwavemelancholicelectric guitar
ethereal tones blend with shadowy ambience.
ethereal tones blend with shadowy ambience.
whispers beneath moonlight
02:00110 BPMA minor
gothdarkwavebittersweetviolin
ancient corridors filled with ghostly whispers
ancient corridors filled with ghostly whispers
echoes of the forgotten
01:3385 BPME minor
goth rockdark waveeeriesynthesizer
gothic instrumental with shadows and mysterious midnight tones
gothic instrumental with shadows and mysterious midnight tones
moonlit gothic shadows
01:57145 BPMC# minor
gothdarkwavebroodingelectric guitar
mysterious violin serenades lost love
mysterious violin serenades lost love
echoes of velvet darkness
01:54105 BPMD minor
goth rockromantic gothetherealviolin
a dark instrumental exploring despair amid haunting gothic soundscapes.
a dark instrumental exploring despair amid haunting gothic soundscapes.
haunting echoes of despair
01:55110 BPME minor
gothic rockdarkwavesinisterelectric guitar
haunting gothic melodies
haunting gothic melodies
veiled shadows glide
02:0065 BPME minor
rockgothmysteriouselectric guitar
dark haunting melodies with deep emotional resonance.
dark haunting melodies with deep emotional resonance.
whispers in velvet shadows
01:41120 BPMA minor
gothethereal wavemelancholicsynthesizer
melodic shadows dance under lunar glow.
melodic shadows dance under lunar glow.
echoes in the darkness
02:00120 BPMA minor
gothdarkwavebittersweetviolin
eerie echoes meet dark, haunting melodies
eerie echoes meet dark, haunting melodies
whispers in shadowed halls
01:4985 BPMA minor
goth rockdark waveeeriesynthesizer
evocative gothic emotionality with a sensual touch.
evocative gothic emotionality with a sensual touch.
velvet night's caress
01:26135 BPME minor
gothdarkwavemournfulviolin
delicate haunting melodies in dark soothing tones
delicate haunting melodies in dark soothing tones
ethereal soft shadows
01:45160 BPMD major
gothethereal gothmelancholicpiano
dark, brooding soundscapes with eerie undertones
dark, brooding soundscapes with eerie undertones
shadows creep silently
01:2690 BPMD minor
goth rockdarkwavemenacingpipa
gothic melodies intertwined with ethereal dreamlike soundscapes
gothic melodies intertwined with ethereal dreamlike soundscapes
nocturnal dreamscapes unveiled
01:52110 BPMD major
gothdream popbroodingelectric guitar
eerie and atmospheric dark rock with haunting presence.
eerie and atmospheric dark rock with haunting presence.
moonlit darkness descends
01:35150 BPME minor
rockgothic rockbroodingelectric guitar
distant echoes with deep guitar, synth melodic whispers.
distant echoes with deep guitar, synth melodic whispers.
gothic melancholy dreamscape
01:57140 BPMD minor
gothgothic rockhauntingelectric guitar
an instrumental voyage into haunting, brooding gothic soundscapes.
an instrumental voyage into haunting, brooding gothic soundscapes.
midnight veil descends
01:55160 BPMA minor
gothic rockdarkwavebroodingelectric guitar
enigmatic, dark melodies evoking otherworldly realms and emotions.
enigmatic, dark melodies evoking otherworldly realms and emotions.
mystic shadows dance
01:1095 BPMA minor
gothdarkwavemysteriouscello
dark, atmospheric instrumental with eerie, contemplative undertones
dark, atmospheric instrumental with eerie, contemplative undertones
haunting midnight shadows
01:2590 BPME minor
populardark popcreepysynthesizer
haunting melodies in a desolate, eerie soundscape.
haunting melodies in a desolate, eerie soundscape.
ethereal shadows weep
01:08105 BPMA minor
gothdarkwavemelancholicpiano
soft, haunting synths with deep emotional undercurrent.
soft, haunting synths with deep emotional undercurrent.
ghostly veil serenade
01:42105 BPMD minor
gothethereal wavemelancholicsynthesizer
majestic melodies with haunting ethereal ambient undercurrents
majestic melodies with haunting ethereal ambient undercurrents
ethereal gothic reverie
01:3590 BPMC major
gothambient gothicempoweredviolin
haunting dark melody with driving rock rhythms.
haunting dark melody with driving rock rhythms.
mystic night's descent
01:50145 BPMD minor
rockgothic rockbroodingelectric guitar
a haunting and melancholic instrumental piece
a haunting and melancholic instrumental piece
dark whispers in the night
01:5790 BPMA minor
gothdarkwavedarkelectric guitar
synths swell in melancholic, dark theatric soundscape
synths swell in melancholic, dark theatric soundscape
eclipse of forgotten dreams
01:52170 BPMD minor
darkwavegothic darkwavebittersweetsynthesizer
ethereal soundscapes meet dark rhythmic pulses
ethereal soundscapes meet dark rhythmic pulses
shadows creep silently
02:00135 BPMA minor
darkwavegothicmysterioussynthesizer
a dark instrumental weaving despair with haunting guitar melodies.
a dark instrumental weaving despair with haunting guitar melodies.
shadows fall eternal
02:00130 BPME minor
gothic rockdarkwavesinisterelectric guitar
gothic elegance intertwines with melodic violin soundscapes.
gothic elegance intertwines with melodic violin soundscapes.
gothic rose elegantly blooming
01:34170 BPMA minor
gothicclassical gothicmelancholicviolin
melancholic, gothic atmospheres with futuristic synth landscapes.
melancholic, gothic atmospheres with futuristic synth landscapes.
neon shadows under moon
01:50150 BPMA minor
gothfuturistic gothmelancholicsynth
echoing forlorn notes filling the darkest corners
echoing forlorn notes filling the darkest corners
silent shadows weeping
01:51120 BPMA minor
gothdarkwavebleakelectric guitar
powerful, dark instrumental evoking intense gothic anger and energy
powerful, dark instrumental evoking intense gothic anger and energy
gothic rage unleashed
01:2595 BPME minor
gothdeathrockangryelectric guitar
mysterious, majestic darkwave with enchanting and ominous vibes.
mysterious, majestic darkwave with enchanting and ominous vibes.
haunting ethereal majesty
01:5295 BPMD minor
darkwavemajestic darkwaveominoussynthesizer
an eerie instrumental journey through gothic darkness and melancholy.
an eerie instrumental journey through gothic darkness and melancholy.
echoes of the abyss
01:19170 BPMB minor
gothic rockdarkwavebroodingelectric guitar
gothic tones uplift through haunting atmospheric melodies
gothic tones uplift through haunting atmospheric melodies
resilient shadows rising
01:19160 BPMA minor
gothethereal wavehopefulelectric guitar