StockTune: Free stock music and songs
StockCake: Free AI stock photosAI Photossite en eng us femipro comhdhub4u movie download in hindi mveenaindianphonknostalgicrhythmicbollywoodserenesad beatsmusic boxdsdfluteindian flutesbackground musicsynthesizerfreeclassicalraag bhairavirock
Float through an eerie soundscape of ghostly, neon tinted synths, blending a dark and dreamy atmosphere that is both unsettling and mesmerizing
Public DomainAI Generated

Neon Twilight Ghosts

Haunting Bass Synths With Otherworldly Melodies Floating Through

120 BPMC minor00:59

Float through an eerie soundscape of ghostly, neon tinted synths, blending a dark and dreamy atmosphere that is both unsettling and mesmerizing

synthesizergothtrippydarkmoodyeeriegothsurrealdarkwaveetherealsynthbasshauntingominous

Related Tags

hauntinghauntingeerieeeriedarkwavedarkwaveetherealetherealsynthsynthatmosphericatmosphericgothicgothic120 bpm120 bpmmysteriousmysteriousdarkdarkambientambientbassbass

Similar Stock Music

abstract synth melodies layered with haunting bass lines
abstract synth melodies layered with haunting bass lines
eclipsed neon shadows
01:44125 BPMD# minor
gothtrippydarksynthesizer
eerie melodies ride on surreal, haunting waves.
eerie melodies ride on surreal, haunting waves.
whispers in the void
01:15120 BPMF minor
dream popsinisterhauntingsynthesizer
delicate yet unsettling ambiance for nocturnal reflections.
delicate yet unsettling ambiance for nocturnal reflections.
echoes of silence
01:55110 BPMG minor
dream popsinisterhauntingsynthesizer
a haunting symphony
a haunting symphony
eternal night’s embrace
01:58115 BPME minor
gothdarkwavemysteriouspiano
a haunting blend of trippy darkwave atmospheres.
a haunting blend of trippy darkwave atmospheres.
ethereal shadow dance
01:57125 BPMD minor
darkwavetrippyeeriesynthesizer
creepy groovy tune with eerie hypnotic beats
creepy groovy tune with eerie hypnotic beats
groovy shadows' dance
01:50120 BPMC minor
funkdark funkcreepybass guitar
haunting melodies, darkwave beats, evokes nocturnal mystical journeys.
haunting melodies, darkwave beats, evokes nocturnal mystical journeys.
mystic nightfall soundscape
02:00125 BPMA minor
darkwavedreamwavemysterioussynthesizer
surreal, ambient melodies unfold in hypnotic darkwave soundscapes.
surreal, ambient melodies unfold in hypnotic darkwave soundscapes.
ghostly synth reverie
01:35135 BPMA minor
darkwavetrippyeeriesynthesizer
ethereal darkwave journey with majestic synth textures
ethereal darkwave journey with majestic synth textures
nocturnal majesty encompassed
01:52140 BPME minor
darkwavemajestic darkwaveeeriesynthesizer
majestic darkwave song with deep, haunting synth melodies
majestic darkwave song with deep, haunting synth melodies
moonlit shadows' reverent ballad
02:00150 BPMD minor
darkwavemajestic darkwaveeeriesynthesizer
haunting, serene sounds for nighttime.
haunting, serene sounds for nighttime.
nocturnal echo reveries
01:17120 BPMC minor
ambientpsybientetherealsynthesizer
dark tones meld with powerful beats.
dark tones meld with powerful beats.
shadows within silence
01:42120 BPMD minor
goth rockethereal wavemysteriouspipe organ
mysterious sounds framed in gloomy darkwave rhythms
mysterious sounds framed in gloomy darkwave rhythms
shadows linger here
01:50120 BPMA minor
darkwavegothicetherealsynthesizer
eerie soundscape with haunting melodies and gothic atmosphere
eerie soundscape with haunting melodies and gothic atmosphere
ethereal midnight wraiths
01:24130 BPME minor
gothdarkwaveeeriesynthesizer
brooding darkwave with menacing undercurrents and eerie tones.
brooding darkwave with menacing undercurrents and eerie tones.
haunting shadows descent
01:58120 BPMA minor
darkwavesynthwavemenacingelectric guitar
darker tones, deeper fears emerging
darker tones, deeper fears emerging
night engulfs the shadows
01:39110 BPMD minor
darkwavegothicdarksynthesizer
dark, ethereal atmosphere with powerful, haunting melodies.
dark, ethereal atmosphere with powerful, haunting melodies.
shadowed gothic majesty
01:4985 BPMC# minor
gothdarkwavehauntingsynthesizer
dark haunting melody with ethereal vocals and synths
dark haunting melody with ethereal vocals and synths
ethereal shadows descend
01:40135 BPMG minor
darkwaveethereal darkwaveetherealsynthesizer
eerie bass pulses meet haunting electronic wind
eerie bass pulses meet haunting electronic wind
echoes in the darkness
01:50140 BPME minor
dubstepbrostepsinistersynthesizer
ethereal soundscape with dark, trippy undertones and haunting melodies
ethereal soundscape with dark, trippy undertones and haunting melodies
gothic dream sequence
01:51100 BPMC minor
gothdarkwaveetherealelectric guitar
dark, sinister melodies engulf twilight realms.
dark, sinister melodies engulf twilight realms.
shadows creep underneath
02:00120 BPMD minor
goth rockdarkwavecreepyelectric guitar
melodic darkness infused with powerful atmospheric elements.
melodic darkness infused with powerful atmospheric elements.
nocturnal eclipse serenade
01:56120 BPME minor
darkwavegothmysterioussynthesizer
gothic and ethereal themes with haunting harmonic layers
gothic and ethereal themes with haunting harmonic layers
shadow realm reverie
01:56155 BPMG minor
gothdarkwaveeeriesynthesizer
melancholic guitar and lush synth create dreamy goth feelings
melancholic guitar and lush synth create dreamy goth feelings
haunting twilight reverie
01:43120 BPMB minor
gothdream popmelancholicguitar
haunting soundscape of velvet night.
haunting soundscape of velvet night.
echoes in darkness
01:54120 BPMD minor
darkwaveethereal wavemysterioussynthesizer
synths and organ craft haunting soundscape
synths and organ craft haunting soundscape
moonlit ethereal echoes
01:46150 BPMA minor
goth rockdarkwaveetherealorgan
eerie soundscapes with creepy synth layers.
eerie soundscapes with creepy synth layers.
nightfall's ominous whisper
01:44120 BPMB minor
darkwavegothicmenacingsynthesizer
soft echoes of midnight create haunting, ethereal soundscape
soft echoes of midnight create haunting, ethereal soundscape
midnight velvet echoes
01:38130 BPMA minor
ethereal gothdarkwavehauntingsynthesizer
soundtracks for ghostly encounters, deeply atmospheric
soundtracks for ghostly encounters, deeply atmospheric
shadows of despair
01:44110 BPMA minor
darkwavegothiccreepysynthesizer
low rumbles under eerie synths overlay
low rumbles under eerie synths overlay
bass shadows whispering
01:42150 BPMF minor
dubstepbrostepsinistersynthesizer
dark, atmospheric composition with deep bass and haunting melodies.
dark, atmospheric composition with deep bass and haunting melodies.
majestic shadows awaken
01:50105 BPMC minor
darkwavemajestic darkwaveominoussynthesizer
haunting future bass evoking mysterious astral landscapes
haunting future bass evoking mysterious astral landscapes
ethereal night visions
02:00160 BPMF minor
future bassethereal trapmysterioussynthesizer
eerie ambient echoes in darkness.
eerie ambient echoes in darkness.
moonlit synth landscapes
02:00180 BPMC minor
ambientpsybientetherealsynthesizer
an eerie yet vibrant blend of funky goth soundscapes
an eerie yet vibrant blend of funky goth soundscapes
dark funky electric groove
01:54140 BPME minor
funkgothdarkelectric guitar
delicate sounds amidst profound silence
delicate sounds amidst profound silence
echoes in the darkness
01:46120 BPMC minor
ambientdark ambientanxiousethereal pad
aggressive goth instrumental evoking dark, intense atmosphere.
aggressive goth instrumental evoking dark, intense atmosphere.
dark moon visions
01:59165 BPMA minor
gothaggressive gothdarkdistorted guitar
deep, bold rhythms with an ethereal, haunting goth soundscape.
deep, bold rhythms with an ethereal, haunting goth soundscape.
haunting gothic symphony
01:3790 BPMD# minor
gothdarkwavehauntingsynthesizer
mysterious beats enveloping deep, dark rhythms.
mysterious beats enveloping deep, dark rhythms.
shadows conquer daylight
01:24140 BPMB minor
darkwavegoth rockdarkelectric guitar
a vibrant blend of eerie funky and gothic soundscapes
a vibrant blend of eerie funky and gothic soundscapes
haunting goth funk beat
01:32135 BPMA minor
funkgothdarkelectric guitar
creepy beats blending with eerie atmospheric elements
creepy beats blending with eerie atmospheric elements
haunted bassline echoes
01:40120 BPMA minor
drum and bassdarkstepominousbass guitar
deep, eerie sounds evoke spirits lurking
deep, eerie sounds evoke spirits lurking
ghosts lurk silently
01:47155 BPMF minor
ethereal wavedarkwaveominoussynthesizer
dark, trippy, ethereal soundscape with haunting gothic melodies
dark, trippy, ethereal soundscape with haunting gothic melodies
ethereal gothic reverie
01:4390 BPME minor
gothdarkwaveetherealelectric guitar
inspiring future bass evoking ethereal cosmic dreams
inspiring future bass evoking ethereal cosmic dreams
mystical astral journey
01:58155 BPMF# minor
future bassethereal trapmysterioussynthesizer
melodies swirl in deepening twilight shadows.
melodies swirl in deepening twilight shadows.
echoes beneath moonlight
03:58120 BPMF minor
darkwaveneoclassical darkwaveeeriesynthesizer
dissonant echoes in the dark night
dissonant echoes in the dark night
midnight shadow play
02:00125 BPMC minor
electrodarkwavesinistersynthesizer
capturing solitude in an echoing soundscape
capturing solitude in an echoing soundscape
whispers in the void
01:54115 BPMC minor
ambientdark ambientcreepysynthesizer
dark waves crashing, mood somber
dark waves crashing, mood somber
shadows consume the night
01:45100 BPME minor
darkwavegothicdarksynthesizer
haunting echo of distant gothic symphonies
haunting echo of distant gothic symphonies
echoes of the dark cathedral
01:59115 BPMD minor
gothsinister gotheerieelectric guitar
dark, eerie, haunting goth music with unsettling chimes.
dark, eerie, haunting goth music with unsettling chimes.
whispers of the crypt
01:31110 BPMC minor
gothdarkwaveeeriechimes
dark, mysterious, and tension filled goth instrumental track
dark, mysterious, and tension filled goth instrumental track
midnight shadows unveiled
01:54110 BPMA minor
gothdarkwavemysterioussynthesizer
navigate the haunting ethereal sounds
navigate the haunting ethereal sounds
echoes in darkness
01:08150 BPMC minor
darkwaveneoclassical darkwaveeeriesynthesizer
eerie synths meet bass heavy rhythms.
eerie synths meet bass heavy rhythms.
whispers from tomorrow
02:00130 BPME minor
future basschillstepmysterioussynthesizer
eerie dubstep with haunting melodies.
eerie dubstep with haunting melodies.
whispers in the void
01:3475 BPME minor
dubstepdarkwavecreepysynthesizer
dark, menacing tones with pulsating rhythm.
dark, menacing tones with pulsating rhythm.
shadow's grasp beckons
01:46145 BPME minor
rockgoth rockmenacingbass guitar
power surges through ethereal darkness.
power surges through ethereal darkness.
embrace the night shadows
01:47160 BPMA minor
goth rockethereal wavemysteriouspipe organ
an ethereal wave soundscape, hauntingly chaotic.
an ethereal wave soundscape, hauntingly chaotic.
whispers from the void
02:00120 BPMC minor
ethereal wavechaoticetherealsynthesizer
ethereal melodies evoke a haunting introspective journey.
ethereal melodies evoke a haunting introspective journey.
gothic shadows whisper truths
01:27100 BPMA minor
darkwaveintrospectivebroodingsynthesizer
dark sounds with haunting synth lines
dark sounds with haunting synth lines
echoes through darkness
04:00130 BPMA minor
dubstepdarkwavemysterioussynthesizer
energizing goth sounds mingle with modern beats
energizing goth sounds mingle with modern beats
dark echoes from within
01:30140 BPMD minor
goth rockenergetic gothenergeticsynthesizer
haunting sounds echoing darkness bends
haunting sounds echoing darkness bends
echoes of the night
01:25120 BPMBb major
dark popelectronicmysterioussynthesizer
mysterious darkwave piece invoking dreamy gothic night moods.
mysterious darkwave piece invoking dreamy gothic night moods.
gothic moonlit dreamscape darkwave
01:4295 BPMA minor
darkwavedreamwavemysterioussynthesizer
dark, futuristic vibes with ethereal synth soundscapes
dark, futuristic vibes with ethereal synth soundscapes
neon shadows rising
01:15135 BPMC minor
darkwavefuturistic darkwaveforebodingsynthesizer
haunting synths creating an ethereal, mysterious nighttime atmosphere
haunting synths creating an ethereal, mysterious nighttime atmosphere
misty midnight enigma
01:4390 BPME minor
darkwavedreamy darkwavemysterioussynthesizer
eerie, ethereal, and haunting, this trippy goth instrumental captivates
eerie, ethereal, and haunting, this trippy goth instrumental captivates
trippy gothic nightshade
01:29130 BPMC minor
gothgothic rockeeriesynthesizer
enigmatic pulses hover over ethereal melodies.
enigmatic pulses hover over ethereal melodies.
shadows whisper softly
02:00160 BPMF minor
future basschillstepetherealsynthesizer
dark, liberating soundscape with ethereal and mysterious tones.
dark, liberating soundscape with ethereal and mysterious tones.
ethereal nighttime liberation
01:51120 BPMG minor
darkwaveethereal waveliberatingsynthesizer
melodies in a haunted castle setting
melodies in a haunted castle setting
echoes in the dark
01:56155 BPMG minor
goth rockdarkwavemysterioussynthesizer
haunting synths intertwine with sensual, dark melodies, creating allure.
haunting synths intertwine with sensual, dark melodies, creating allure.
moonlit velvet shadows
01:34120 BPMA minor
darkwavesensual darkwavesensualsynthesizer
energetic goth track with whimsical shadowy festival atmosphere
energetic goth track with whimsical shadowy festival atmosphere
shadowy festival dance
01:50120 BPMA minor
gothdarkwavesinistersynthesizer
reflective and mysterious tune encompassing deep haunting sounds
reflective and mysterious tune encompassing deep haunting sounds
mystical acoustic darkness
01:55125 BPMA minor
darkwavesoulful darkwavemysterioussynthesizer
eerie soundscapes, haunting atmospheric melodies guide you.
eerie soundscapes, haunting atmospheric melodies guide you.
whispers of the forgotten
02:0095 BPME minor
goth rockdarkwavemysterioussynthesizer
eerie, pulsing beats with dark enchanting synth melodies
eerie, pulsing beats with dark enchanting synth melodies
ghostly night frequencies
01:52130 BPMA minor
edmdarkwaveeeriesynthesizer
intense, dark electronic beats with relentless, driving force
intense, dark electronic beats with relentless, driving force
eclipse of dark beats
01:21120 BPME minor
edmdarkdarksynthesizer
dark, atmospheric, ethereal, infused with haunting melodies
dark, atmospheric, ethereal, infused with haunting melodies
midnight velvet shadows
01:54110 BPMD minor
darkwavegothicmysterioussynthesizer
eerie synth layers meet haunting melodies
eerie synth layers meet haunting melodies
whispers in the void
01:58140 BPME minor
synthpopgothic synthpopmysterioussynthesizer
synths swirl in haunting harmony.
synths swirl in haunting harmony.
echoes of the future
01:58140 BPMF minor
future basschillstepmysterioussynthesizer
dark synthwave with pulsing dystopian bass lines
dark synthwave with pulsing dystopian bass lines
neon shadowed chaos
01:2995 BPMA minor
synthwavedarkwavemenacingsynthesizer
haunting bass-driven track
haunting bass-driven track
shadows lurk below
02:0090 BPMBb minor
electronicdark ambientsinisterelectric bass
dark, pulsating beats with eerie, atmospheric synth waves
dark, pulsating beats with eerie, atmospheric synth waves
ethereal midnight echoes
01:33130 BPMD minor
edmdarkwaveeeriesynthesizer
soulful goth instrumental evoking deep emotions and haunting melodies
soulful goth instrumental evoking deep emotions and haunting melodies
whispers in the abyss
01:46120 BPMD minor
gothic rockdarkwavemelancholicelectric guitar
creepy funk with eerie, groovy synths and hypnotic bass
creepy funk with eerie, groovy synths and hypnotic bass
haunted funky beats
01:35135 BPME minor
funkdark funkcreepybass guitar
brooding synths and rhythmic echoes create sinister soundscape
brooding synths and rhythmic echoes create sinister soundscape
haunted echoes unveil
01:50120 BPMC minor
darkwaveminimalist darkwaveominoussynthesizer
mysterious soundscapes, chilling, echoing deeply
mysterious soundscapes, chilling, echoing deeply
echoes from the abyss
01:59160 BPMG minor
darkwavegothiccreepysynthesizer
haunting melodies under shimmering moonlight evoke ethereal dreams
haunting melodies under shimmering moonlight evoke ethereal dreams
moonlit gothic reverie
01:57100 BPME minor
ethereal gothdarkwavehauntingsynthesizer
darkwave track with thrilling and spooky ambiance
darkwave track with thrilling and spooky ambiance
haunting velvet shadows
01:59115 BPMC minor
darkwavedark ambientsuspensefulsynthesizer
dark atmospheric backdrop with hauntingly beautiful melodies.
dark atmospheric backdrop with hauntingly beautiful melodies.
ethereal midnight dreamscape
01:24120 BPME minor
gothdarkwavemysteriouselectric guitar
dark, dreamy atmosphere with haunting melodic structures
dark, dreamy atmosphere with haunting melodic structures
nebulous night forest
01:32115 BPMC major
darkwavedreamy darkwavemysterioussynthesizer
brooding darkwave track filled with pulsing dread.
brooding darkwave track filled with pulsing dread.
menacing shadows approach
01:53105 BPMC minor
darkwavesynthwavemenacingelectric guitar
haunting guitar riffs with ethereal atmospheric synth backdrops
haunting guitar riffs with ethereal atmospheric synth backdrops
midnight shadows dance darkly
01:52155 BPMA minor
goth rockdarkwavemysteriouselectric guitar
dark, eerie song with heavy bass
dark, eerie song with heavy bass
shadows creep silently in
01:56150 BPME minor
darkwavegoth rocksinisterelectric bass
haunting synthwave melody with brooding electronic ambiance
haunting synthwave melody with brooding electronic ambiance
nightmare neon shadows
01:50120 BPMC minor
synthwavedarkwaveforebodingsynthesizer
enigmatic beats meet hauntingly deep basslines.
enigmatic beats meet hauntingly deep basslines.
whispers beneath shadows
01:31140 BPMD minor
dubstepsinister dubstepsinistersynthesizer
sonic depths explored through soft, resonant waves.
sonic depths explored through soft, resonant waves.
echoes beneath waters
01:46110 BPMD# minor
ambientethereal wavemysterioussynthesizer
cityscape mixed with eerie ambient and dark beats.
cityscape mixed with eerie ambient and dark beats.
creepy city night sounds
01:57120 BPMC minor
darkwaveambientdisturbingsynthesizer
chilling synth odyssey in a shadowy, malevolent soundscape
chilling synth odyssey in a shadowy, malevolent soundscape
witching hour's enigma
00:03140 BPMBb minor
darkwavegothic darkwavecreepysynthesizer
dark textures flow through haunting electric melodies.
dark textures flow through haunting electric melodies.
night's silent whisper
01:5675 BPMC major
darkwavegoth rockdarkelectric guitar
dark tones with haunting melodies.
dark tones with haunting melodies.
shadows creep at midnight
02:00140 BPMB minor
darkwavegothicmenacingsynthesizer
modern goth fusion with pulsating energy
modern goth fusion with pulsating energy
mystic beats of shadow
01:55155 BPMD minor
goth rockenergetic gothenergeticsynthesizer