StockTune: Free stock music and songs
StockCake: Free AI stock photosAI Photospan flutemp3 downloader juice free musicsitar and tablaepicelectric guitarfunkviolinpersian traditionalsoft polkaindian instrumentalmelancholicacoustic guitarindian villageindian musicserenepunjabi bhangrainstrumentalhindicorporatedark
A nostalgic instrumental piece that captures the essence of sun soaked days from the past, using vintage synthesizers and mellow rhythms to evoke a sense of warm, bygone summers. Ideal for recalling cherished memories.
Public DomainAI Generated

Retro Sunshine Polaroid Memories

Instrumental Nostalgic Track Invoking Retro Sunny Memories.

95 BPMC minor01:22

A nostalgic instrumental piece that captures the essence of sun soaked days from the past, using vintage synthesizers and mellow rhythms to evoke a sense of warm, bygone summers. Ideal for recalling cherished memories.

synthesizersynthwaveretronostalgicwarmreflectivevintagesynthwaveretroinstrumentalnostalgic1980smellowhappy

Related Tags

synthwavesynthwaveretroretronostalgicnostalgic80s80sinstrumentalinstrumentaldreamydreamyreflectivereflective90bpm90bpmambientambientmellowmellow95 bpm95 bpmmelancholicmelancholic

Similar Stock Music

instrumental track capturing sunny nostalgic memories perfectly.
instrumental track capturing sunny nostalgic memories perfectly.
golden summer memory lane
01:50100 BPME minor
synthwaveretronostalgicsynthesizer
nostalgic synthwave tune with deep emotional undertones
nostalgic synthwave tune with deep emotional undertones
retro memories in neon
02:0085 BPMC minor
synthwaveretrowavenostalgicsynthesizer
nostalgic 80s synth adventure full of shimmering arpeggios.
nostalgic 80s synth adventure full of shimmering arpeggios.
retro synth dreamscape
01:5790 BPME minor
new waveretro wavenostalgicsynthesizer
a dreamy instrumental journey through retro synth landscapes.
a dreamy instrumental journey through retro synth landscapes.
neon twilight echoes
01:5980 BPMD minor
ambientsynthwavenostalgicsynthesizer
emotional journey through nostalgic synthwave with deep sentiments
emotional journey through nostalgic synthwave with deep sentiments
neon dreams of yesterday
01:32100 BPMA minor
synthwaveretrowavenostalgicsynthesizer
an atmospheric 80s instrumental reflecting on past memories.
an atmospheric 80s instrumental reflecting on past memories.
neon rain reflections
01:2685 BPMC minor
synthwaveambientnostalgicsynthesizer
melancholic synthpop tune that reminisces on love and loss
melancholic synthpop tune that reminisces on love and loss
memories fade away
02:0095 BPMA minor
synthpopretro synthwavebittersweetsynthesizer
melancholic synths evoke memories of a distant, fading past.
melancholic synths evoke memories of a distant, fading past.
echoes of lost time
01:30105 BPME minor
synthwaveretrowavemelancholicsynthesizer
an uplifting tune that evokes warm memories of yesteryears.
an uplifting tune that evokes warm memories of yesteryears.
whispers from the past
01:3890 BPMD major
synthwavechillwavenostalgichammond organ
soft shimmering synths evoke peaceful eighties nostalgia.
soft shimmering synths evoke peaceful eighties nostalgia.
floating neon night walks
01:2590 BPMG minor
synthwavechillwavenostalgicsynthesizer
evokes bittersweet nostalgia with haunting synths and atmospheric sounds.
evokes bittersweet nostalgia with haunting synths and atmospheric sounds.
lost in neon dreams
01:56105 BPMA minor
synthwaveretrowavemelancholicsynthesizer
a reflective look at forgotten nostalgic times past
a reflective look at forgotten nostalgic times past
memories in dust
01:5495 BPMC minor
synthwaveambient synthwavenostalgicsynthesizer
nostalgic and dreamy instrumental with modern touches
nostalgic and dreamy instrumental with modern touches
sunset memories return
02:0080 BPMC major
indienünostalgicsynthesizer
smooth synth sounds evoking mellow 80s moments
smooth synth sounds evoking mellow 80s moments
dreamy 80s nostalgia
01:4095 BPMG minor
synthwavechillwavedreamysynthesizer
instrumental retro melodies evoking warm and reflective nostalgia.
instrumental retro melodies evoking warm and reflective nostalgia.
nostalgic retro rewind
01:4690 BPME minor
retrosynthwavenostalgicsynthesizer
ethereal synths meet nostalgic 80s soundscapes
ethereal synths meet nostalgic 80s soundscapes
lost in neon lights
01:2590 BPMA minor
synthpopretronostalgicsynthesizer
shimmery synths create warm, nostalgic, dreamy soundscapes.
shimmery synths create warm, nostalgic, dreamy soundscapes.
shimmering twilight memories
01:42120 BPMC major
synthpopretro synthpopnostalgicsynthesizer
a calming instrumental with 80s retro vibes.
a calming instrumental with 80s retro vibes.
neon twilight serenity
01:35110 BPMB minor
synthwavechillwavenostalgicsynthesizer
a smooth, soulful instrumental capturing 80s vibes and nostalgia
a smooth, soulful instrumental capturing 80s vibes and nostalgia
soulful neon nights
01:3685 BPMD minor
synthwave80s soulnostalgicsynthesizer
floating through a dreamlike synth melody.
floating through a dreamlike synth melody.
neon reflections journey
01:5890 BPMA minor
synthwavereflective synthwavenostalgicsynthesizer
evoke nostalgia through gentle melodies and warm retro tones
evoke nostalgia through gentle melodies and warm retro tones
echoes of yesteryear
02:0085 BPMC major
synthwavechillwavereflectiveelectric piano
haunting synth melodies over nostalgic beats evoke lost times.
haunting synth melodies over nostalgic beats evoke lost times.
echoes of distant memories
01:5190 BPME minor
synthwaveretrowavemelancholicsynthesizer
instrumental harmonies that take listeners back to cherished times.
instrumental harmonies that take listeners back to cherished times.
echoes of old times
02:00115 BPMA minor
synthwavechillwavenostalgichammond organ
an energetic retro instrumental that brings back the 80s vibe.
an energetic retro instrumental that brings back the 80s vibe.
neon nights groove
01:46110 BPMC minor
discosynthwavejoyfulsynthesizer
synthwave ballad filled with tender nostalgic melodies
synthwave ballad filled with tender nostalgic melodies
neon sunset serenades
01:5690 BPMC minor
synthwaveretrowavenostalgicsynthesizer
electronic instrumental evoking nostalgic 80s vibes and memories past
electronic instrumental evoking nostalgic 80s vibes and memories past
echoes of yesterday
01:33100 BPMC minor
synthwaveretrowavenostalgicsynthesizer
evoke memories with soothing retro tunes and gentle rhythms
evoke memories with soothing retro tunes and gentle rhythms
reflections in time
01:40115 BPME minor
synthwavechillwavereflectiveelectric piano
a gentle instrumental embodying the nostalgic 80s synth sound.
a gentle instrumental embodying the nostalgic 80s synth sound.
whispers of neon
01:2795 BPMG major
synthpopambientnostalgicsynthesizer
a soothing journey through sound with retro vibes
a soothing journey through sound with retro vibes
echoes of past melodies
01:56100 BPMD minor
retrosynthwaveheartwarmingelectric piano
inspiring and vibrant retro melodies creating nostalgic joy
inspiring and vibrant retro melodies creating nostalgic joy
radiant nostalgic soundscape
01:51100 BPME minor
synthwave1980sjoyfulsynthesizer
an evocative synth melody that captures nostalgic 80s feelings.
an evocative synth melody that captures nostalgic 80s feelings.
shadows of neon nights
01:48100 BPMC minor
synthwaveambient synthwavenostalgicsynthesizer
gentle 80s inspired instrumental relaxing and nostalgic mood.
gentle 80s inspired instrumental relaxing and nostalgic mood.
retro sunset glow
01:5895 BPMC major
synthwavechillwavenostalgicsynthesizer
synthpop song with emotional retro vibes and warmth
synthpop song with emotional retro vibes and warmth
melancholic synthwave echoes
01:1590 BPME minor
synthpopsoulful synthpopnostalgicsynthesizer
instrumental synthwave track capturing nostalgic feelings of past times
instrumental synthwave track capturing nostalgic feelings of past times
memories in vinyl
01:44150 BPMA minor
synthwaveretrowavenostalgicsynthesizer
a nostalgic instrumental blending retro synths and heartfelt melodies.
a nostalgic instrumental blending retro synths and heartfelt melodies.
lost in retro melodies
01:30100 BPMA minor
synthwavechillwavenostalgicsynthesizer
gleaming retro synthwave with dreamy soothing lush pads
gleaming retro synthwave with dreamy soothing lush pads
retro twilight dream sequence
01:3590 BPMC major
synthwavedreamwavenostalgicsynthesizer
emotional 80s synth instrumental reflecting on past heartfelt memories
emotional 80s synth instrumental reflecting on past heartfelt memories
echoes of yesterday
01:5895 BPMC major
synthwaveambient synthwavenostalgicsynthesizer
infectious synth rhythms bringing joyous summer driving experience
infectious synth rhythms bringing joyous summer driving experience
coastal sunset adventure
01:3990 BPMC minor
new wavesynthpopjoyfulsynthesizer
a somber instrumental reflecting on nostalgic memories through retro sounds
a somber instrumental reflecting on nostalgic memories through retro sounds
echoes of distant memories
01:5095 BPMC major
ambientsynthwavemelancholicsynthesizer
melancholic synths weave a tapestry of nostalgic electronic sounds
melancholic synths weave a tapestry of nostalgic electronic sounds
lost in neon lights
01:5795 BPMC major
synthwaveretrowavereflectivesynthesizer
dreamy instrumental with nostalgic 80s j pop vibes
dreamy instrumental with nostalgic 80s j pop vibes
sunset memory lane
01:3495 BPMBb minor
j popretro j popnostalgicsynthesizer
a nostalgic instrumental embracing 80s soul and synthwave elements
a nostalgic instrumental embracing 80s soul and synthwave elements
midnight echoes soul
01:08120 BPME minor
synthwave80s soulnostalgicsynthesizer
bright, uplifting melodies with retro influences
bright, uplifting melodies with retro influences
echoes of neon dreams
01:55125 BPMC minor
synthpopuplifting synthpopjoyfulsynthesizer
evokes past dreams with shimmering nostalgic synth melodies
evokes past dreams with shimmering nostalgic synth melodies
neon dreams remembered
01:45170 BPMC major
synthpopretro synthpopnostalgicsynthesizer
nostalgic tones blend with retro vibes
nostalgic tones blend with retro vibes
silent whispers of past
01:4090 BPMD minor
electronicsynthwavenostalgicmellotron
an instrumental evoking nostalgia and contemplative reflections on time.
an instrumental evoking nostalgia and contemplative reflections on time.
whispers of old times
01:1995 BPMA minor
synthwavedreamwavenostalgicsynthesizer
calm 80s synths evoke retro feeling
calm 80s synths evoke retro feeling
neon nightscape reflections
01:18100 BPMC major
synthwavechillwavenostalgicsynthesizer
modern synths meet retro beats, creating an energetic dance track.
modern synths meet retro beats, creating an energetic dance track.
back to neon future
01:13100 BPMD minor
synthwaveretro waveexcitedsynthesizer
a retro triumph song with powerful synths and driving beats.
a retro triumph song with powerful synths and driving beats.
neon victory anthem
01:5090 BPMD minor
synthwaveretro electrotriumphantsynthesizer
synth waves evoke powerful nostalgia
synth waves evoke powerful nostalgia
neon dreams revisited
01:31105 BPMA minor
synthpopretronostalgicsynthesizer
a vibrant synthwave piece capturing happiness and nostalgic vibes
a vibrant synthwave piece capturing happiness and nostalgic vibes
neon dreams unfold
01:2995 BPME minor
synthwaveretrowavehappysynthesizer
feel the vintage vibes uplifting every beat
feel the vintage vibes uplifting every beat
echoes of liberation
02:00100 BPME minor
retrosynthpoplivelyelectric piano
captures the heartfelt essence of 80s with synth
captures the heartfelt essence of 80s with synth
heartstrings of yesterday
01:2190 BPMA minor
80ssynthwavenostalgicsynthesizer
optimistic 80s instrumental featuring bright synths and energetic beats.
optimistic 80s instrumental featuring bright synths and energetic beats.
radiant synthwave journey
01:5595 BPMC major
synthwaveretrowaveenergeticsynthesizer
bright synths and upbeat rhythms inspire hope and optimism.
bright synths and upbeat rhythms inspire hope and optimism.
embracing tomorrow's glow
01:3095 BPMC major
synthwaveretrowaveenergeticsynthesizer
serene synth melodies for tranquil neon lit nights
serene synth melodies for tranquil neon lit nights
calm neon nights
01:4695 BPMD minor
new wavesynthwavenostalgicsynthesizer
modern meets vintage in nostalgic waves
modern meets vintage in nostalgic waves
whispers of the past
02:0090 BPMC major
chillwaveatmosphericcontemplativeelectric piano
a nostalgic melody evoking passionate memories of bygone romance
a nostalgic melody evoking passionate memories of bygone romance
echoes of lost love
01:3890 BPMA minor
synthwaveretrowavepassionatesaxophone
a nostalgic 80s synth track capturing longing and lost love.
a nostalgic 80s synth track capturing longing and lost love.
lost in neon dreams
01:5790 BPMA minor
synthwaveretrowavemelancholicsynthesizer
an instrumental 80s synthwave track evoking nostalgia and longing.
an instrumental 80s synthwave track evoking nostalgia and longing.
echoes of lost love
01:5590 BPMA minor
synthwaveretrowavemelancholicsynthesizer
relaxing synthesizer melodies paint a peaceful 80s sunset
relaxing synthesizer melodies paint a peaceful 80s sunset
lush neon reverie
01:40100 BPMA minor
synthwaveambient synthnostalgicsynthesizer
reflective retro instrumental with comforting nostalgic melodies reliving memories.
reflective retro instrumental with comforting nostalgic melodies reliving memories.
retro days reflection
01:16105 BPME minor
retrosynthwavenostalgicsynthesizer
reflective melody with nostalgic undertones
reflective melody with nostalgic undertones
echoes through time
01:45100 BPMC minor
synthwaveretro futuristicnostalgicsynthesizer
perfect blend of old and new inspirational sounds
perfect blend of old and new inspirational sounds
echoes from the past
01:59100 BPMC minor
retrosynthwaveinspiringsynthesizer
uplifting beats, nostalgic vibes, soaring melodies.
uplifting beats, nostalgic vibes, soaring melodies.
sunset drive neon dreams
01:2195 BPMC minor
synthwaveuplifting synthwaveenergeticsynthesizer
inspiring retro sound with vibrant melodies and harmonies
inspiring retro sound with vibrant melodies and harmonies
sunlit retro dreamscape
01:45110 BPME minor
synthwave1980sjoyfulsynthesizer
upbeat synthwave journey with lively melodies and energetic vibes.
upbeat synthwave journey with lively melodies and energetic vibes.
ride the neon wave
01:56120 BPME minor
synthwaveretrowavecheerfulsynthesizer
retro sounds meet modern grooves.
retro sounds meet modern grooves.
groovy time travel beats
01:50105 BPME minor
retrosynthwaveenergeticelectric piano
gentle synthwave journey through nostalgic and dreamy soundscapes.
gentle synthwave journey through nostalgic and dreamy soundscapes.
whispers of neon skies
01:1090 BPMA minor
synthwavedreamwavedreamysynthesizer
glowing synth nostalgia with shimmering retro electronic textures
glowing synth nostalgia with shimmering retro electronic textures
neon dreams return
01:5595 BPME minor
synthwaveretrowavenostalgicsynthesizer
instrumental track blending synthpop and nostalgia with dreamy melodies
instrumental track blending synthpop and nostalgia with dreamy melodies
neon nights remembered
01:3195 BPMB minor
synthpopretrowavenostalgicsynthesizer
dreamy instrumental intertwining retro synths, ethereal melodies, nostalgic vibes.
dreamy instrumental intertwining retro synths, ethereal melodies, nostalgic vibes.
echoes of neon dreams
01:2785 BPMC minor
synthwavechillwavenostalgicsynthesizer
shimmering synths evoke nostalgic, dreamy 80s soundscapes
shimmering synths evoke nostalgic, dreamy 80s soundscapes
retro neon horizon
01:45165 BPMC minor
synthwavedreamwavedreamlikesynthesizer
evokes lonely nostalgia through retro melancholic melodies and harmonies.
evokes lonely nostalgia through retro melancholic melodies and harmonies.
lost vintage love letters
01:5290 BPMC major
retrosynthwavenostalgicelectric guitar
high energy synth tracks capturing 80s vibes of excitement
high energy synth tracks capturing 80s vibes of excitement
neon lights velocity
01:10130 BPMD minor
synthwaveoutrunenergeticsynthesizer
a calming synth journey through the heart of neon city.
a calming synth journey through the heart of neon city.
city lights reverie
01:4485 BPMA minor
new wavechillwavenostalgicsynthesizer
gentle melodies inspired by the eighties nostalgia.
gentle melodies inspired by the eighties nostalgia.
neon dreams floating by
01:5590 BPMC major
synthwavechillwavenostalgicsynthesizer
a motivating 80s synth journey that inspires with nostalgia
a motivating 80s synth journey that inspires with nostalgia
neon horizons rise
01:4490 BPME minor
synthwavedreamwavehopefulsynthesizer
upbeat synth melodies with rhythmic, driving beats.
upbeat synth melodies with rhythmic, driving beats.
neon dreams horizon
01:5595 BPMB minor
synthwaveretrowaveupliftingsynthesizer
a whimsical journey through sunlit 80s inspired soundscapes
a whimsical journey through sunlit 80s inspired soundscapes
retro sunshine drive
01:55105 BPMA minor
synthwaveretro wavejoyfulsynthesizer
smooth 80s instrumental of neon lit city night drive
smooth 80s instrumental of neon lit city night drive
midnight city drive
01:3895 BPMA minor
synthwaveretro futurismnostalgicsaxophone
synths weave through nostalgic digital landscapes
synths weave through nostalgic digital landscapes
echoes through neon rain
01:58140 BPMB minor
new wavesynthpopreflectivesynthesizer
instrumental chillwave track radiating energy through dreamy synth melodies.
instrumental chillwave track radiating energy through dreamy synth melodies.
neon horizons awaken
01:5790 BPMC minor
chillwavesynthwaveeuphoricsynthesizer
evokes nostalgic sunsets through gentle synth melodies and beats
evokes nostalgic sunsets through gentle synth melodies and beats
neon sunset dreams
01:4485 BPMB major
synthwavechillwavedreamyanalog synthesizer
a joyful ode to 1980s synth music
a joyful ode to 1980s synth music
retro synth celebration
01:3095 BPMF minor
synthwave80s popupliftingsynthesizer
tender new wave with nostalgic shimmering synth melodies
tender new wave with nostalgic shimmering synth melodies
retro hues serenade
01:35130 BPME minor
new wavesynthpopnostalgicsynthesizer
upbeat, nostalgic 80s instrumental evoking pure optimism
upbeat, nostalgic 80s instrumental evoking pure optimism
neon dreams awaken
01:3190 BPME minor
synthwaveretro waveoptimisticsynthesizer
melodies that evoke past emotions
melodies that evoke past emotions
echoes of yesteryears
01:58100 BPMA minor
retrosynthwavemelancholicsynthesizer
bright synths and energetic beats inspire joyful nostalgic feelings
bright synths and energetic beats inspire joyful nostalgic feelings
neon nights journey
01:53105 BPMD minor
synthwaveoutrunjoyfulsynthesizer
retro melancholic tunes with gentle wistful moods.
retro melancholic tunes with gentle wistful moods.
forgotten romantic melodies
01:4695 BPMG major
retrosynthwavenostalgicelectric guitar
calming instrumental with nostalgic 80s synth vibes
calming instrumental with nostalgic 80s synth vibes
retro sunset waves
01:4090 BPMG minor
synthwaveretronostalgicsynthesizer
instrumental synth melodies invoking dreamy nostalgia of past evenings.
instrumental synth melodies invoking dreamy nostalgia of past evenings.
sunset memory glows
01:51110 BPMEb major
ambientsynthwavenostalgicsynthesizer
an epic 80s instrumental with intense synths.
an epic 80s instrumental with intense synths.
neon nighttime battle
01:4595 BPMA minor
synthwaveretrowaveheroicsynthesizer
nostalgic melody with mellow, dreamy and retro vibes
nostalgic melody with mellow, dreamy and retro vibes
golden era midnight daydream
01:55100 BPMG major
synthwavedreamwavenostalgicsynthesizer
an intimate 80s instrumental evoking nostalgia, warmth, and romance
an intimate 80s instrumental evoking nostalgia, warmth, and romance
whispers under neon lights
01:55100 BPMG minor
synthwaveambient synthwaveintimatesynthesizer
evoking lost youth with shimmering synths and pulsing beats.
evoking lost youth with shimmering synths and pulsing beats.
neon memories fade
01:3490 BPMA minor
electropopsynthwavenostalgicsynthesizer
a soothing blend of retro synths and ambient textures.
a soothing blend of retro synths and ambient textures.
memories in neon glow
02:0090 BPMC major
chillwavesynthpopnostalgicsynthesizer