StockTune: Free stock music and songs
StockCake: Free AI stock photosAI Photossitar110 bpmbollywooddark ambientreflectiveepic orchestralindiabackground musicinstrumental jewish100 bpmnaa telugu mp3 songs download freeguzhengindianrapbrutal deathcoreserenefolkgentle alarmboom bapsynthesizer
An atmospheric track that hues closely to a cinematic sound, designed to immerse the listener in the depths of a forgotten epoch, dominated by a haunting pipe organ that guides through a spectral auditory landscape.
Public DomainAI Generated

Echoes In The Darkness

Soft Whispers Amidst Profound Silence

130 BPMA minor01:54

An atmospheric track that hues closely to a cinematic sound, designed to immerse the listener in the depths of a forgotten epoch, dominated by a haunting pipe organ that guides through a spectral auditory landscape.

pipe organgothicdarkwavemysteriouseeriemelancholichauntinggothicdarkpipe organdarkwavecinematicimmersiveatmospheric

Related Tags

hauntinghauntinggothicgothicatmosphericatmosphericdarkwavedarkwaveeerieeeriemelancholicmelancholicshadowsshadowscinematiccinematicbroodingbroodingetherealetherealdarkdarkmysteriousmysteriousimmersiveimmersive

Similar Stock Music

eerie melody throbbing through shadowy corridors
eerie melody throbbing through shadowy corridors
whispers of the forgotten
01:58140 BPME minor
gothicdarkwavemysteriouspipe organ
ethereal echoes form mournful, evocative atmosphere
ethereal echoes form mournful, evocative atmosphere
shadows of silence
01:51135 BPMC minor
darkwavegothic darkwavebittersweetsynthesizer
hauntingly atmospheric track with eerie, hypnotic undertones.
hauntingly atmospheric track with eerie, hypnotic undertones.
eclipsed nocturnal whispers
01:48120 BPME minor
darkwavegothic darkwaveeeriesynthesizer
twisting, dark melodies for an unsettling, suspenseful instrumental journey
twisting, dark melodies for an unsettling, suspenseful instrumental journey
eerie capriccio shadows
01:38115 BPME minor
avant gardeneoclassical darkwavesinisterviolin
synths swell in melancholic, dark theatric soundscape
synths swell in melancholic, dark theatric soundscape
eclipse of forgotten dreams
01:52170 BPMD minor
darkwavegothic darkwavebittersweetsynthesizer
dark, twisting melodies create suspenseful, eerie instrumental journey
dark, twisting melodies create suspenseful, eerie instrumental journey
shadowed capriccio nightmare
01:50155 BPMA minor
avant gardeneoclassical darkwavesinisterviolin
melodic shadows dance under lunar glow.
melodic shadows dance under lunar glow.
echoes in the darkness
02:00120 BPMA minor
gothdarkwavebittersweetviolin
a haunting orchestral journey
a haunting orchestral journey
whispers in the shadows
01:58125 BPMA minor
darkgothiceerieorchestral
haunting melodies echo through gothic cathedral chambers
haunting melodies echo through gothic cathedral chambers
eerie cathedral shadows
01:27150 BPMD minor
gothdarkwavegloomyorgan
dark organ echoes fill solemn, gothic reverberating shadows
dark organ echoes fill solemn, gothic reverberating shadows
midnight gothic whispers
01:31140 BPMA minor
gothdarkwavebroodingorgan
ethereal tones blend with shadowy ambience.
ethereal tones blend with shadowy ambience.
whispers beneath moonlight
02:00110 BPMA minor
gothdarkwavebittersweetviolin
eerie echoes resonate, creating a chilling, dark atmosphere
eerie echoes resonate, creating a chilling, dark atmosphere
echoes in hidden corners
01:40115 BPMD minor
dark ambientunnerving dark ambientunnervingsynthesizer
ethereal sounds capturing melancholic, isolated emotions artfully.
ethereal sounds capturing melancholic, isolated emotions artfully.
murky depths unveiled
02:00140 BPMD minor
gothpost punkmelancholicelectric guitar
dark, sinister melodies engulf twilight realms.
dark, sinister melodies engulf twilight realms.
shadows creep underneath
02:00120 BPMD minor
goth rockdarkwavecreepyelectric guitar
gothic ballad with soul, deeply emotional and haunting.
gothic ballad with soul, deeply emotional and haunting.
seraphic midnight melodies
01:58130 BPME minor
gothdarkwavemelancholicpiano
dark enigmatic soundscape
dark enigmatic soundscape
moonlit shadows cast
01:58110 BPME minor
gothdarkwavesinisterelectric guitar
eerie melodies mingling within an atmospheric gothic soundscape.
eerie melodies mingling within an atmospheric gothic soundscape.
midnight gothic reverie
01:49160 BPME minor
gothpost punkbroodingelectric guitar
haunting reverberations echo with chilling gothic overtones
haunting reverberations echo with chilling gothic overtones
shadowed midnight cathedral
01:11130 BPME minor
gothdarkwavebroodingorgan
ethereal melodies with intense dark atmospheric undertones
ethereal melodies with intense dark atmospheric undertones
haunted midnight shadows
01:59145 BPMA minor
gothdarkwaveetherealsynthesizer
a sad, instrumental piece evoking deep melancholy and mystery
a sad, instrumental piece evoking deep melancholy and mystery
weeping shadows of night
01:4885 BPMD minor
gothdarkwavemelancholicviolin
a dark instrumental echoing lament of forgotten spirits
a dark instrumental echoing lament of forgotten spirits
echoes lost in time
01:57135 BPMA minor
gothdarkwavemelancholiccello
dark ethereal melodies mixed with deep haunting textures.
dark ethereal melodies mixed with deep haunting textures.
veil of shadows
01:41180 BPMA minor
gothdarkwavenostalgicsynthesizer
eerie echoes meet sultry, dark melodies.
eerie echoes meet sultry, dark melodies.
whispers in gothic halls
01:55125 BPMD minor
gothdarkwavemysteriouschurch organ
an instrumental voyage into haunting, brooding gothic soundscapes.
an instrumental voyage into haunting, brooding gothic soundscapes.
midnight veil descends
01:55160 BPMA minor
gothic rockdarkwavebroodingelectric guitar
soft tones under moon's glow
soft tones under moon's glow
midnight whispers echo
01:40130 BPMA minor
darkwavegothiceeriepiano
sonic tapestry of eerie, haunting melodies.
sonic tapestry of eerie, haunting melodies.
whispers of the abyss
04:00125 BPME minor
ambientdark ambientmelancholiccello
ominous tones meet nostalgic, melancholic melodics
ominous tones meet nostalgic, melancholic melodics
shadows on silent walls
01:53120 BPMA minor
darkwavegothicbittersweetsynthesizer
dark tones echo through a cavernous soundscape
dark tones echo through a cavernous soundscape
shadows loom large
01:04150 BPMG# minor
gothdarkwaveangryelectric guitar
brooding, atmospheric composition with deep, resonant undertones.
brooding, atmospheric composition with deep, resonant undertones.
shadows of the abyss
01:5690 BPMF minor
darkwavegothic darkwaveeeriesynthesizer
dark atmospheric sounds with hauntingly surreal undertones.
dark atmospheric sounds with hauntingly surreal undertones.
eclipsed midnight reverie
01:55115 BPMG minor
gothdarkwavenostalgicsynthesizer
haunting melody resonates with dark atmospheric ambiance.
haunting melody resonates with dark atmospheric ambiance.
eclipsed shadows lament
01:56150 BPMA minor
darkwavesad darkwavemelancholicsynthesizer
eerie sounds spiral in nocturnal echoes.
eerie sounds spiral in nocturnal echoes.
midnight whispers call
01:5580 BPMD# minor
goth rockdarkwavecreepyelectric guitar
venturing into the heart of darkness with resonating strings
venturing into the heart of darkness with resonating strings
echoes in the dark
02:00135 BPMA minor
gothdarkwaveangryelectric guitar
mysterious, haunting synths echo in brooding darkwave journey
mysterious, haunting synths echo in brooding darkwave journey
echoes of dark abyss
01:50120 BPMA minor
darkwavegothic darkwavemysterioussynthesizer
melancholic tune evoking sorrowful memories and introspection
melancholic tune evoking sorrowful memories and introspection
haunted midnight tears
01:3690 BPME minor
gothdarkwavemelancholicviolin
eerie darkwave with echoing synth and dissonant melodies
eerie darkwave with echoing synth and dissonant melodies
gothic cathedral halls
01:53130 BPMC minor
gothdarkwaveeeriesynth
a serene journey through eerie gothic soundscapes
a serene journey through eerie gothic soundscapes
midnight murmurs echo tranquil
01:59125 BPMC minor
gothdarkwavemelancholiccello
gothic melodies intertwined with electric rhythms, vibrant sound adventure
gothic melodies intertwined with electric rhythms, vibrant sound adventure
haunted electric fairground
01:35140 BPMA minor
gothdarkwavehauntingelectric guitar
dark melodies with an atmospheric haunting energy
dark melodies with an atmospheric haunting energy
ethereal gothic enchantment
01:56125 BPMF minor
gothdarkwaveetherealsynthesizer
mystical, dark composition with eerie electric guitar melodies
mystical, dark composition with eerie electric guitar melodies
haunting midnight whispers
01:44110 BPME minor
gothdarkwaveeerieelectric guitar
intensely eerie with ghostly guitar echoes
intensely eerie with ghostly guitar echoes
whispers in shadows
01:39130 BPME minor
rockgoth rockmysteriouselectric guitar
echoes of love amidst gothic night's veil.
echoes of love amidst gothic night's veil.
shadows embrace the night
01:27120 BPMB minor
darkwavegothic darkwavemysterioussynthesizer
a tense gothic instrumental exploring shadows and silent ruins
a tense gothic instrumental exploring shadows and silent ruins
shadows amidst silent ruins
02:00165 BPME minor
gothic rockdarkwavetenseelectric guitar
evocative, dark, atmospheric soundscape
evocative, dark, atmospheric soundscape
whispers in the dark
01:40140 BPMA minor
darkwavegothicmelancholicsynthesizer
longing melodies in a dark atmosphere
longing melodies in a dark atmosphere
echoes of silent voices
01:57140 BPMA minor
darkwavegothicmelancholicsynthesizer
foreboding melodies weaving through shadows and eerie atmospherics
foreboding melodies weaving through shadows and eerie atmospherics
bleak shadows looming dark
01:57150 BPMB minor
dark ambientdronebroodingsynthesizer
menacing, brooding track with eerie darkwave undercurrents
menacing, brooding track with eerie darkwave undercurrents
dark gothic presence
01:50120 BPMA minor
gothdarkwaveominousguitar
undulating dark melodies with eerie atmospheric undertones.
undulating dark melodies with eerie atmospheric undertones.
nocturnal shadows embrace
01:46105 BPME minor
gothpost punkbroodingelectric guitar
tenebrous beats envelop mournful synthesizers within shadowy soundscapes.
tenebrous beats envelop mournful synthesizers within shadowy soundscapes.
celestial sorrow symphony
01:39160 BPMA minor
darkwavesad darkwavemelancholicsynthesizer
gothic, eerie pipe organ haunting, emotionally evocative music
gothic, eerie pipe organ haunting, emotionally evocative music
spectral whispered reverie
01:5880 BPMA minor
cinematicgothic ambienteeriepipe organ
a haunting journey into the depths of the mysterious unknown
a haunting journey into the depths of the mysterious unknown
shadows of the unknown
01:58150 BPMA minor
dark ambientcinematic dark ambientmysteriousorgan
haunting melody summons a mystical auditory realm
haunting melody summons a mystical auditory realm
echoes from beyond
01:59110 BPMA minor
darkwaveneoclassical darkwaveeerietheremin
mysterious and dark, building tension effortlessly.
mysterious and dark, building tension effortlessly.
night's ominous whisper
01:24140 BPMD minor
goth rockdarkwavemenacingelectric guitar
aggressive tones with goth influences create unease.
aggressive tones with goth influences create unease.
dark shadows looming now
01:48125 BPMD minor
goth rockdarkwavemenacingelectric guitar
a haunting instrumental journey through shadows and gothic echoes
a haunting instrumental journey through shadows and gothic echoes
echoes of lost souls
01:45155 BPME minor
gothic rockdarkwavetenseelectric guitar
dark, atmospheric track with haunting melodies and chilling vibes
dark, atmospheric track with haunting melodies and chilling vibes
eerie gothic shadows
01:42155 BPMD minor
gothdarkwaveeerieelectric guitar
organ tones craft haunting, mystical atmospheres.
organ tones craft haunting, mystical atmospheres.
echoes through ancient vaults
01:34155 BPME minor
gothdarkwavemysteriouschurch organ
a haunting melody on a dark night
a haunting melody on a dark night
shadows creep silently
01:45140 BPMA minor
darkwavegothiceeriepiano
atmospheric soundscape, shadows embrace darkness within.
atmospheric soundscape, shadows embrace darkness within.
underworld's nocturnal embrace
01:55150 BPMA minor
gothpost punkgrittyelectric guitar
tense gothic atmosphere filled with eerie, melancholic textures
tense gothic atmosphere filled with eerie, melancholic textures
shadows whispering through walls
02:00100 BPMA minor
gothdarkwaveeeriesynth
echoes in an empty manor house
echoes in an empty manor house
whispers of the forgotten
04:00120 BPMA minor
ambientdark ambienteerietheremin
eerie, majestic darkwave invoking midnight cathedral ambiance
eerie, majestic darkwave invoking midnight cathedral ambiance
ethereal midnight choir
01:53150 BPMA minor
darkwavemajestic darkwavemysterioussynthesizer
a haunting instrumental exploring despair and depths of sorrow
a haunting instrumental exploring despair and depths of sorrow
shadows embrace eternity
01:45140 BPMG minor
gothdarkwavemelancholiccello
an eerie instrumental journey through gothic darkness and melancholy.
an eerie instrumental journey through gothic darkness and melancholy.
echoes of the abyss
01:19170 BPMB minor
gothic rockdarkwavebroodingelectric guitar
deep bass pulses, haunting melodies, intense.
deep bass pulses, haunting melodies, intense.
shadows lurk below
01:55115 BPMC minor
darkwavegothiceeriesynthesizer
unnerving instrumental goth piece with unsettling whispers and shadows
unnerving instrumental goth piece with unsettling whispers and shadows
whispering shadows lurking
01:35150 BPMC minor
gothdarkwavedarkpiano
ethereal soundscape with dark, trippy undertones and haunting melodies
ethereal soundscape with dark, trippy undertones and haunting melodies
gothic dream sequence
01:51100 BPMC minor
gothdarkwaveetherealelectric guitar
an eerie journey through dark, surreal soundscapes.
an eerie journey through dark, surreal soundscapes.
ethereal shadows embrace
01:55155 BPME minor
dark ambientgothicetherealelectric guitar
haunting, rhythmic organ echoes in darkness
haunting, rhythmic organ echoes in darkness
midnight's gothic reverie
01:33150 BPMF minor
gothdarkwavehauntingorgan
eerie, dark, atmospheric, brooding piece with haunting resonance.
eerie, dark, atmospheric, brooding piece with haunting resonance.
haunted shadows gothic echoes
01:57150 BPMC minor
gothdarkwavesinisterharmonium
gothic synths weaving eerie melancholy soundscapes at midnight
gothic synths weaving eerie melancholy soundscapes at midnight
ethereal shadows looming dark
01:55130 BPMC minor
darkwaveethereal wavemysterioussynthesizer
enigmatic and haunting tunes enveloped in celestial whispers
enigmatic and haunting tunes enveloped in celestial whispers
fog veiled moonlight mysteries
01:58140 BPMA minor
ethereal waveambient gothicbroodingsynthesizer
intense dark soundscape leads listener through shadowy despair
intense dark soundscape leads listener through shadowy despair
whispers of the abyss
02:00120 BPMB minor
darkwaveneoclassical darkwavebleakorgan
soft echoes of midnight create haunting, ethereal soundscape
soft echoes of midnight create haunting, ethereal soundscape
midnight velvet echoes
01:38130 BPMA minor
ethereal gothdarkwavehauntingsynthesizer
eerie echoes forming an immersive soundscape
eerie echoes forming an immersive soundscape
whispers of the void
01:50105 BPMD minor
darkwaveneoclassical darkwaveeerietheremin
a hauntingly sensual goth instrumental with dark undertones.
a hauntingly sensual goth instrumental with dark undertones.
dark whispering shadows
01:55120 BPMA minor
gothgoth rockseductiveguitar
a dark, eerie journey through ghostly soundscapes of despair.
a dark, eerie journey through ghostly soundscapes of despair.
midnight echoes whispering ghosts
01:58155 BPMA minor
darkwavegotheeriesynthesizer
a haunting instrumental exploring surreal, dark, and dreamy realms.
a haunting instrumental exploring surreal, dark, and dreamy realms.
shadows of ethereal dreams
01:3695 BPMA minor
dark ambientgothicetherealelectric guitar
haunting melodies weave through gothic shadows, invoking mystic realms.
haunting melodies weave through gothic shadows, invoking mystic realms.
enchanted midnight waltz
01:39130 BPMB minor
gothdarkwavemysteriouscello
ghostly echoes in a spacious manor
ghostly echoes in a spacious manor
whispers from the past
01:46110 BPMA minor
oldiesgothic oldiesominouspiano
spectral sounds blending soul and punk influences
spectral sounds blending soul and punk influences
echoes in the void
01:59160 BPMA minor
soulpunkmelancholicelectric guitar
dark atmospheric backdrop with hauntingly beautiful melodies.
dark atmospheric backdrop with hauntingly beautiful melodies.
ethereal midnight dreamscape
01:24120 BPME minor
gothdarkwavemysteriouselectric guitar
dark soundscapes and ominous church organ echo.
dark soundscapes and ominous church organ echo.
echoes through darkness
01:27120 BPME minor
goth rockdarkwavesinisterchurch organ
dark, brooding instrumental with menacing goth overtones
dark, brooding instrumental with menacing goth overtones
haunting shadows emerge
01:27115 BPMA minor
gothdarkwaveominousguitar
melancholic, gothic atmospheres with futuristic synth landscapes.
melancholic, gothic atmospheres with futuristic synth landscapes.
neon shadows under moon
01:50150 BPMA minor
gothfuturistic gothmelancholicsynth
a sinister blend of cello and atmospheric tension
a sinister blend of cello and atmospheric tension
dreadful night symphony
01:39130 BPMA minor
soundtrackdark ambientominouscello
mysterious melodies with layered sophisticated darkwave soundscapes
mysterious melodies with layered sophisticated darkwave soundscapes
shadowed gothic reverie
01:31160 BPMD minor
darkwavesophisticated darkwavebroodingsynthesizer
haunting melody echoing a soul's endless yearning.
haunting melody echoing a soul's endless yearning.
eternal winter's embrace
01:45160 BPMG# minor
gothdarkwavelongingelectric guitar
mysterious darkwave with haunting melodies and eerie rhythms.
mysterious darkwave with haunting melodies and eerie rhythms.
whispers through eternal shadows
01:30130 BPME minor
darkwavesynthwavemysterioussynthesizer
intense goth anthem with haunting melodies and rhythms.
intense goth anthem with haunting melodies and rhythms.
nightshade vortex symphony
01:57130 BPMA minor
gothdarkwaveintenseelectric guitar
melancholic darkwave, haunting ethereal echoes
melancholic darkwave, haunting ethereal echoes
echoes of lost time
01:55140 BPME minor
darkwavesoulful darkwavehauntingsynthesizer
haunting melodies draped in eerie, unsettling darkness.
haunting melodies draped in eerie, unsettling darkness.
midnight shadows creeping
02:00110 BPMA minor
ambientdark ambientdarktheremin
dark, trippy, ethereal soundscape with haunting gothic melodies
dark, trippy, ethereal soundscape with haunting gothic melodies
ethereal gothic reverie
01:4390 BPME minor
gothdarkwaveetherealelectric guitar
dark, driving beats with haunting, melancholic synth melodies
dark, driving beats with haunting, melancholic synth melodies
nightfall's shadowed serenade
01:52150 BPMD minor
darkwavedramaticominoussynthesizer
a dark goth instrumental enveloping listeners in haunting soundscapes
a dark goth instrumental enveloping listeners in haunting soundscapes
shadows embrace eternal night
01:46170 BPMA minor
gothic rockdarkwavedarkpipe organ
voices whispering hidden secrets
voices whispering hidden secrets
echoes in the darkness
02:27150 BPMA minor
rockgothic rockmysteriouselectric guitar
eerie, spine tingling music evoking haunted landscapes and foreboding shadows
eerie, spine tingling music evoking haunted landscapes and foreboding shadows
ghostly echoes reverberating
01:43145 BPMD minor
cinematicgothic ambienteeriepipe organ
intriguing gothic atmosphere
intriguing gothic atmosphere
eternal shadows speak
01:58145 BPME minor
gothdarkwavemysteriouselectric guitar
distant echoes with deep guitar, synth melodic whispers.
distant echoes with deep guitar, synth melodic whispers.
gothic melancholy dreamscape
01:57140 BPMD minor
gothgothic rockhauntingelectric guitar