StockTune: Free stock music and songs
StockCake: Free AI stock photosAI Photosrapacoustic guitarbrutal deathcoreupliftingindian classical fusioninstrumental reggaebirthday musicgroovy hip hophdhub4u download all bollywood movies in hindidarkmoroccanpianonostalgick popcalminstrumental gospelpunjabi dhol100 bpmviolincountry
This composition paints an audial picture of ethereal whispers and ghostly melodies under a moonlit sky, with a violin leading the mystical journey, supported by a backdrop of darkwave elements that suggest a gentle yet haunting narrative of lost eras and romance.
Public DomainAI Generated

Echoes In The Darkness

Melodic Shadows Dance Under Lunar Glow.

120 BPMA minor02:00

This composition paints an audial picture of ethereal whispers and ghostly melodies under a moonlit sky, with a violin leading the mystical journey, supported by a backdrop of darkwave elements that suggest a gentle yet haunting narrative of lost eras and romance.

violingothdarkwavebittersweetmelancholicmysterioushauntingviolingothicetherealshadowsmoonlightspectralimmersivedarkwave

Related Tags

hauntinghauntingdarkwavedarkwavegothicgothicetherealetherealshadowsshadowsmelancholicmelancholicatmosphericatmosphericeerieeerieambientambient120 bpm120 bpmimmersiveimmersivenightnight

Similar Stock Music

ethereal tones blend with shadowy ambience.
ethereal tones blend with shadowy ambience.
whispers beneath moonlight
02:00110 BPMA minor
gothdarkwavebittersweetviolin
ethereal melodies with intense dark atmospheric undertones
ethereal melodies with intense dark atmospheric undertones
haunted midnight shadows
01:59145 BPMA minor
gothdarkwaveetherealsynthesizer
soft whispers amidst profound silence
soft whispers amidst profound silence
echoes in the darkness
01:54130 BPMA minor
gothicdarkwavemysteriouspipe organ
hauntingly atmospheric track with eerie, hypnotic undertones.
hauntingly atmospheric track with eerie, hypnotic undertones.
eclipsed nocturnal whispers
01:48120 BPME minor
darkwavegothic darkwaveeeriesynthesizer
dark melodies with an atmospheric haunting energy
dark melodies with an atmospheric haunting energy
ethereal gothic enchantment
01:56125 BPMF minor
gothdarkwaveetherealsynthesizer
dark, atmospheric tones fueling unfolding gothic narrative
dark, atmospheric tones fueling unfolding gothic narrative
eternal midnight's embrace
01:50150 BPMB minor
gothdarkwaveeerieelectric guitar
eerie gothic vibes, haunting and mesmerizing, perfect ambiance.
eerie gothic vibes, haunting and mesmerizing, perfect ambiance.
ethereal darkened shadows
01:29110 BPME minor
gothgothic rockhauntingelectric guitar
ethereal melodies hovering over dark, hypnotic soundscapes
ethereal melodies hovering over dark, hypnotic soundscapes
mystical gothic dreamweaver
01:58120 BPMA minor
gothdarkwavemysteriouselectric guitar
a hauntingly sensual goth instrumental with dark undertones.
a hauntingly sensual goth instrumental with dark undertones.
dark whispering shadows
01:55120 BPMA minor
gothgoth rockseductiveguitar
soft echoes of midnight create haunting, ethereal soundscape
soft echoes of midnight create haunting, ethereal soundscape
midnight velvet echoes
01:38130 BPMA minor
ethereal gothdarkwavehauntingsynthesizer
ethereal soundscape capturing introspective, melancholic, eerie twilight emotions.
ethereal soundscape capturing introspective, melancholic, eerie twilight emotions.
haunting twilight reflections
01:50130 BPMA minor
darkwaveethereal waveintrospectivesynthesizer
haunting melodies weave through gothic shadows, invoking mystic realms.
haunting melodies weave through gothic shadows, invoking mystic realms.
enchanted midnight waltz
01:39130 BPMB minor
gothdarkwavemysteriouscello
haunting melodies under shimmering moonlight evoke ethereal dreams
haunting melodies under shimmering moonlight evoke ethereal dreams
moonlit gothic reverie
01:57100 BPME minor
ethereal gothdarkwavehauntingsynthesizer
ghostly strings play in moonlit enchantment
ghostly strings play in moonlit enchantment
veil of midnight mist
01:59120 BPMC minor
gothicdarkwavemysteriousviolin
chilling lullaby with haunting, relaxing undertones
chilling lullaby with haunting, relaxing undertones
moonlit night's embrace
02:00120 BPMA minor
dark ambientgothicmysteriousmusic box
eerie melody throbbing through shadowy corridors
eerie melody throbbing through shadowy corridors
whispers of the forgotten
01:58140 BPME minor
gothicdarkwavemysteriouspipe organ
dark atmospheric piece with introspective and melancholic twilight vibes.
dark atmospheric piece with introspective and melancholic twilight vibes.
ethereal twilight musings
01:5090 BPMC minor
darkwaveethereal waveintrospectivesynthesizer
haunting darkness with chill melodies, introspective night journey
haunting darkness with chill melodies, introspective night journey
whispers of midnight secrets
01:4080 BPMF# minor
darkwavechillmelancholicsynthesizer
distant echoes with deep guitar, synth melodic whispers.
distant echoes with deep guitar, synth melodic whispers.
gothic melancholy dreamscape
01:57140 BPMD minor
gothgothic rockhauntingelectric guitar
eerie melody swirls in shadowed mist
eerie melody swirls in shadowed mist
shadows whisper secrets
01:50120 BPMC minor
darkwavegothic ambientmysteriouspipe organ
a mournful instrumental journey through shadows and despair
a mournful instrumental journey through shadows and despair
whispers in the abyss
01:40100 BPMG minor
gothdarkwavemelancholicchurch organ
enigmatic, dark melodies evoking otherworldly realms and emotions.
enigmatic, dark melodies evoking otherworldly realms and emotions.
mystic shadows dance
01:1095 BPMA minor
gothdarkwavemysteriouscello
gothic tones evoke deep melancholy under twilight's embrace.
gothic tones evoke deep melancholy under twilight's embrace.
midnight shadows lament
01:25180 BPMG minor
gothdarkwavemelancholicharp
a dark instrumental enveloped in sorrowful tones and haunting echoes
a dark instrumental enveloped in sorrowful tones and haunting echoes
shadows of silent ages
01:5880 BPMC minor
gothdarkwavemelancholicchurch organ
haunting synths evoke melancholic yet captivating atmospheres beautifully.
haunting synths evoke melancholic yet captivating atmospheres beautifully.
eclipsing neon shadows
01:22120 BPMA minor
darkwavebittersweetmelancholicsynthesizer
dark, intimate, haunting, and ethereal instrumental gothic emotion.
dark, intimate, haunting, and ethereal instrumental gothic emotion.
velvet shadows embrace
01:28180 BPMF minor
gothdarkwavemelancholicpiano
hauntingly beautiful melody with ethereal, dark undertones.
hauntingly beautiful melody with ethereal, dark undertones.
eclipsing melancholic shadows
02:0090 BPMA minor
gothdarkwavedrearyviolin
gloomy synth textures descend into sonic abyss
gloomy synth textures descend into sonic abyss
moonlit shadows dance
04:00180 BPMA minor
darkwaveneoclassical darkwavemysterioussynthesizer
melancholic tones under a moonlit sky
melancholic tones under a moonlit sky
whispers in the shadows
01:5980 BPMD minor
goth rockdarkwavemysteriousorgan
melancholic guitar and lush synth create dreamy goth feelings
melancholic guitar and lush synth create dreamy goth feelings
haunting twilight reverie
01:43120 BPMB minor
gothdream popmelancholicguitar
gothic synths weaving eerie melancholy soundscapes at midnight
gothic synths weaving eerie melancholy soundscapes at midnight
ethereal shadows looming dark
01:55130 BPMC minor
darkwaveethereal wavemysterioussynthesizer
mystical, dark composition with eerie electric guitar melodies
mystical, dark composition with eerie electric guitar melodies
haunting midnight whispers
01:44110 BPME minor
gothdarkwaveeerieelectric guitar
gothic ballad with soul, deeply emotional and haunting.
gothic ballad with soul, deeply emotional and haunting.
seraphic midnight melodies
01:58130 BPME minor
gothdarkwavemelancholicpiano
ethereal soundscape with dark, trippy undertones and haunting melodies
ethereal soundscape with dark, trippy undertones and haunting melodies
gothic dream sequence
01:51100 BPMC minor
gothdarkwaveetherealelectric guitar
eerie violins under a full moon night
eerie violins under a full moon night
moonlit shadows dance
01:51125 BPME minor
gothicdarkwavemysteriousviolin
gothic melodies arise in the melancholic veil of night.
gothic melodies arise in the melancholic veil of night.
haunting midnight whispers
01:5270 BPMA minor
gothdarkwavemelancholicharp
haunting melody with a chilling, soothing undertone
haunting melody with a chilling, soothing undertone
moonlit shadow's lullaby
01:43130 BPMA minor
dark ambientgothicmysteriousmusic box
rhythmic dark melodies create hypnotic and vibrant atmosphere
rhythmic dark melodies create hypnotic and vibrant atmosphere
gothic night waltz
01:33120 BPME minor
goth rockdarkwaveenchantingsynthesizer
haunting melodies for a melancholic, mysterious atmosphere.
haunting melodies for a melancholic, mysterious atmosphere.
foggy twilight shadows
01:58120 BPMD# minor
darkwavesombermelancholicsynthesizer
**epic journey through shadows with mysteriously haunting melodies.**
**epic journey through shadows with mysteriously haunting melodies.**
**gothic shadows unveiled**
01:34120 BPMA minor
**goth****darkwave****mysterious**violin**
echoes of love amidst gothic night's veil.
echoes of love amidst gothic night's veil.
shadows embrace the night
01:27120 BPMB minor
darkwavegothic darkwavemysterioussynthesizer
haunting melodies echo through gothic cathedral chambers
haunting melodies echo through gothic cathedral chambers
eerie cathedral shadows
01:27150 BPMD minor
gothdarkwavegloomyorgan
haunting echoes resonate through darkness
haunting echoes resonate through darkness
echoes in the void
02:38130 BPMD minor
ambientdark ambientcreepytheremin
haunting gothic instrumental
haunting gothic instrumental
moonlit shadows beckon
02:00125 BPMC major
gothdarkwavemysteriouselectric guitar
dark, trippy, ethereal soundscape with haunting gothic melodies
dark, trippy, ethereal soundscape with haunting gothic melodies
ethereal gothic reverie
01:4390 BPME minor
gothdarkwaveetherealelectric guitar
mysterious melodies with layered sophisticated darkwave soundscapes
mysterious melodies with layered sophisticated darkwave soundscapes
shadowed gothic reverie
01:31160 BPMD minor
darkwavesophisticated darkwavebroodingsynthesizer
haunting melodies with intricate darkwave layers under shadows
haunting melodies with intricate darkwave layers under shadows
gothic nightfall symphony
01:5385 BPME minor
darkwavesophisticated darkwavebroodingsynthesizer
melancholic pipes echo through the dark mist
melancholic pipes echo through the dark mist
echoes of the forgotten
01:54165 BPMA minor
darkwavegothic ambientmysteriouspipe organ
ethereal echoes form mournful, evocative atmosphere
ethereal echoes form mournful, evocative atmosphere
shadows of silence
01:51135 BPMC minor
darkwavegothic darkwavebittersweetsynthesizer
ambient goth soundscape with haunting, hypnotic, otherworldly melodies
ambient goth soundscape with haunting, hypnotic, otherworldly melodies
trippy shadowscape nocturne
01:55150 BPME minor
gothdarkwavemysterioussynthesizer
gothic ambience with deep, contemplative musical expressions.
gothic ambience with deep, contemplative musical expressions.
eternal shadowy reflections
01:57120 BPME minor
gothdarkwavemelancholicelectric guitar
dark, mysterious, and haunting with deep emotional undertones.
dark, mysterious, and haunting with deep emotional undertones.
eclipsed gothic moonlight serenade
01:56130 BPMG minor
gothdarkwavemysteriousorgan
haunting melodies and dreamy dark ambiance intertwined beautifully.
haunting melodies and dreamy dark ambiance intertwined beautifully.
moonlit velvet nightmares
01:54145 BPMA minor
gothethereal gothdreamyharp
ethereal sounds capturing melancholic, isolated emotions artfully.
ethereal sounds capturing melancholic, isolated emotions artfully.
murky depths unveiled
02:00140 BPMD minor
gothpost punkmelancholicelectric guitar
ethereal tones blend into deep shadows
ethereal tones blend into deep shadows
whispers in velvet darkness
01:56130 BPMD minor
goth rockdarkwavemysteriouselectric piano
eerie soundscapes, haunting melodies in the dark
eerie soundscapes, haunting melodies in the dark
whispers of the forgotten
03:52125 BPMD minor
ambientdark ambientcreepytheremin
eerie melodies mingling within an atmospheric gothic soundscape.
eerie melodies mingling within an atmospheric gothic soundscape.
midnight gothic reverie
01:49160 BPME minor
gothpost punkbroodingelectric guitar
a somber instrumental evoking gothic atmospheric dread
a somber instrumental evoking gothic atmospheric dread
eternal shadows dance
02:00140 BPME minor
gothdarkwavemelancholiccello
eternal whispers in timeless shadows
eternal whispers in timeless shadows
echoes from forgotten crypts
04:00120 BPMG minor
darkwaveneoclassical darkwaveeerietheremin
eerie echoes meet sultry, dark melodies.
eerie echoes meet sultry, dark melodies.
whispers in gothic halls
01:55125 BPMD minor
gothdarkwavemysteriouschurch organ
a tense gothic instrumental exploring shadows and silent ruins
a tense gothic instrumental exploring shadows and silent ruins
shadows amidst silent ruins
02:00165 BPME minor
gothic rockdarkwavetenseelectric guitar
eerie soundscape with haunting melodies and gothic atmosphere
eerie soundscape with haunting melodies and gothic atmosphere
ethereal midnight wraiths
01:24130 BPME minor
gothdarkwaveeeriesynthesizer
intimate darkwave piece with haunting melodies and brooding atmosphere
intimate darkwave piece with haunting melodies and brooding atmosphere
whispers through velvet shadows
01:34120 BPMA minor
darkwaveintimate darkwavemelancholicsynthesizer
deep synths and eerie pads weaving melancholy midnight soundscapes.
deep synths and eerie pads weaving melancholy midnight soundscapes.
midnight gothic synthscape
01:58135 BPMA minor
darkwaveethereal wavemysterioussynthesizer
atmospheric beats under haunting moonlit skies
atmospheric beats under haunting moonlit skies
shadows dance at midnight
01:43115 BPMC minor
gothdarkwavehauntingorgan
ethereal echoes in darkness explore mystical depths
ethereal echoes in darkness explore mystical depths
veil of midnight mystery
03:16135 BPME minor
darkwaveneoclassical darkwavemysterioussynthesizer
a soothing instrumental journey blending gentle rhythms and gothic ambience
a soothing instrumental journey blending gentle rhythms and gothic ambience
shadows of silent dreams
01:5590 BPMA minor
darkwaveneoclassical darkwavemelancholiccello
brooding, atmospheric composition with deep, resonant undertones.
brooding, atmospheric composition with deep, resonant undertones.
shadows of the abyss
01:5690 BPMF minor
darkwavegothic darkwaveeeriesynthesizer
menacing, brooding track with eerie darkwave undercurrents
menacing, brooding track with eerie darkwave undercurrents
dark gothic presence
01:50120 BPMA minor
gothdarkwaveominousguitar
haunting, rhythmic organ echoes in darkness
haunting, rhythmic organ echoes in darkness
midnight's gothic reverie
01:33150 BPMF minor
gothdarkwavehauntingorgan
melancholic darkwave, haunting ethereal echoes
melancholic darkwave, haunting ethereal echoes
echoes of lost time
01:55140 BPME minor
darkwavesoulful darkwavehauntingsynthesizer
dark haunting melodies with deep emotional resonance.
dark haunting melodies with deep emotional resonance.
whispers in velvet shadows
01:41120 BPMA minor
gothethereal wavemelancholicsynthesizer
haunted voices echoing through the night
haunted voices echoing through the night
whispers beyond the rift
03:00120 BPME minor
rockgothic rockmysteriouselectric guitar
evocative, dark, atmospheric soundscape
evocative, dark, atmospheric soundscape
whispers in the dark
01:40140 BPMA minor
darkwavegothicmelancholicsynthesizer
longing melodies in a dark atmosphere
longing melodies in a dark atmosphere
echoes of silent voices
01:57140 BPMA minor
darkwavegothicmelancholicsynthesizer
a serene journey through eerie gothic soundscapes
a serene journey through eerie gothic soundscapes
midnight murmurs echo tranquil
01:59125 BPMC minor
gothdarkwavemelancholiccello
a haunting instrumental journey through shadows and gothic echoes
a haunting instrumental journey through shadows and gothic echoes
echoes of lost souls
01:45155 BPME minor
gothic rockdarkwavetenseelectric guitar
gentle, ethereal ambiance with haunting and nostalgic elements
gentle, ethereal ambiance with haunting and nostalgic elements
haunted moonlit reverie
01:51120 BPMD minor
dream popambientetherealsynthesizer
ethereal melodies evoke a haunting introspective journey.
ethereal melodies evoke a haunting introspective journey.
gothic shadows whisper truths
01:27100 BPMA minor
darkwaveintrospectivebroodingsynthesizer
soothing instrumental gothic ambiance with melancholic undertones.
soothing instrumental gothic ambiance with melancholic undertones.
shadowy velvet dusk
01:27115 BPMA minor
gothambientmelancholicviolin
unnerving instrumental goth piece with unsettling whispers and shadows
unnerving instrumental goth piece with unsettling whispers and shadows
whispering shadows lurking
01:35150 BPMC minor
gothdarkwavedarkpiano
haunting melody weaving through dark, atmospheric nightscapes.
haunting melody weaving through dark, atmospheric nightscapes.
ethereal moonlit soundscape
01:2485 BPMA minor
darkwavesmooth darkwaveeeriesynthesizer
dark atmospheric backdrop with hauntingly beautiful melodies.
dark atmospheric backdrop with hauntingly beautiful melodies.
ethereal midnight dreamscape
01:24120 BPME minor
gothdarkwavemysteriouselectric guitar
elegant darkwave with nuanced atmospheric tones
elegant darkwave with nuanced atmospheric tones
shadows linger here
02:00110 BPMA minor
darkwaveethereal waveelegantsynthesizer
undulating dark melodies with eerie atmospheric undertones.
undulating dark melodies with eerie atmospheric undertones.
nocturnal shadows embrace
01:46105 BPME minor
gothpost punkbroodingelectric guitar
deep into the gothic realms with haunting organ
deep into the gothic realms with haunting organ
echoes of forgotten crypts
01:59145 BPMA minor
goth rockdarkwavemysteriousorgan
shadowy echoes meet ethereal depths
shadowy echoes meet ethereal depths
whispers beyond the veil
04:00110 BPMC# minor
darkwaveneoclassical darkwaveeerietheremin
dreamy tones blend into night's embrace
dreamy tones blend into night's embrace
shadows whisper gently
02:00140 BPMA minor
darkwaveethereal waveenigmaticsynthesizer
haunting and mystical, blending the old and new
haunting and mystical, blending the old and new
shadowed gothic dreams
02:00100 BPMA minor
dark artambientgloomytheremin
morose tunes with surreal ambient textures, hauntingly beautiful
morose tunes with surreal ambient textures, hauntingly beautiful
haunted enchanted forest
01:49185 BPMD minor
gothicdream popmysterioussynthesizer
enigmatic piece conjuring gothic, cosmic soundscapes.
enigmatic piece conjuring gothic, cosmic soundscapes.
ethereal nightfall
01:08125 BPMA minor
gothdarkwavemysterioussynthesizer
dark and somber organ for gothic nighttime introspection
dark and somber organ for gothic nighttime introspection
nocturnal cathedral whisper
01:21110 BPMA minor
gothdarkwavesinisterpipe organ
ethereal journey through dark atmospheric soundscapes, deeply immersive.
ethereal journey through dark atmospheric soundscapes, deeply immersive.
moonlit shadows dance
01:46100 BPMA minor
darkwavesmooth darkwaveeeriesynthesizer
dark tones meet haunting ethereal echoes
dark tones meet haunting ethereal echoes
whispers in the shadows
01:58140 BPMA minor
goth rockdarkwavemelancholicelectric guitar
ambient gothic with trippy, otherworldly vibes and haunting melodies
ambient gothic with trippy, otherworldly vibes and haunting melodies
ethereal midnight dreams
02:00100 BPMC# minor
gothdarkwavemysterioussynthesizer
dark, sinister melodies engulf twilight realms.
dark, sinister melodies engulf twilight realms.
shadows creep underneath
02:00120 BPMD minor
goth rockdarkwavecreepyelectric guitar
an ethereal instrumental journey through gentle gothic soundscapes
an ethereal instrumental journey through gentle gothic soundscapes
whispers of gothic dreams
01:35115 BPMG minor
darkwaveneoclassical darkwavemelancholiccello
hauntingly intimate darkwave drenched in shadowed melodies
hauntingly intimate darkwave drenched in shadowed melodies
whispers in the shadows
01:50105 BPMC minor
darkwaveintimate darkwavemelancholicsynthesizer
mysterious, haunting synths echo in brooding darkwave journey
mysterious, haunting synths echo in brooding darkwave journey
echoes of dark abyss
01:50120 BPMA minor
darkwavegothic darkwavemysterioussynthesizer
gloomy synths envelop haunting, ethereal melodies
gloomy synths envelop haunting, ethereal melodies
whispers beyond the veil
04:00125 BPMC minor
darkwavegothic darkwaveeeriesynthesized organ